DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RBL5

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_175667.1 Gene:RBL5 / 841690 AraportID:AT1G52580 Length:309 Species:Arabidopsis thaliana


Alignment Length:251 Identity:58/251 - (23%)
Similarity:102/251 - (40%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFL--VDVIHFQDDPNYQDR------IG 211
            |.|..:|...|..|........|.|....|..:|....|:  ...::..|.|...|.      :|
plant     6 PIPPDIENGPPPPARPHFRPPIPVPWVAWLVPLILAANFVTFATTMYVNDCPARSDECLLFDVLG 70

  Fly   212 ESTSGPAATLFIYNP---------------YKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIA 261
            ..:..|.....:..|               .:..|.||.:|.:::|.|.:|||.|:|..:.:|:.
plant    71 RLSFQPIKENMLLGPSIPTLRKLGALERRLVEEGERWRLISCIWLHGGFLHLMANMISLMCIGMR 135

  Fly   262 LELVHHWWRVGLVYLAGVLAGSMGTSLT---SPRIFLAGASGGVYALITAHIATIIMNYSEMEYA 323
            ||....:.|:|.:|:...|.||:.:.||   ..|:.: ||||.::.|:.|.::.:|.|::..|..
plant   136 LEQEFGFMRIGALYVISGLGGSLVSCLTDSQGERVSV-GASGALFGLLGAMLSELITNWTIYENK 199

  Fly   324 IVQLLAFLVFCFTDLGTSVYRHLTDQHDQIGYV------AHLSGAVAGLLVGIGVL 373
            ...|:..::....:|             .:|::      ||..|.:||..:|..:|
plant   200 CTALMTLILIIVLNL-------------SVGFLPRVDNSAHFGGFLAGFFLGFVLL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 10/43 (23%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 43/172 (25%)
RBL5NP_175667.1 Rhomboid 104..246 CDD:366759 42/153 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.