DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RBL10

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_173900.2 Gene:RBL10 / 839113 AraportID:AT1G25290 Length:343 Species:Arabidopsis thaliana


Alignment Length:226 Identity:47/226 - (20%)
Similarity:92/226 - (40%) Gaps:49/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 PLEGDEPDGAYE--KQMSICPPPLTMVLFSIIEIIMFLVDVIHFQDDPNYQDRIGESTSGPAAT- 220
            |..|:|.....|  |:.::.....|.||.: |.:||::..:               ::.|...| 
plant   106 PRGGEEGSSNPETSKRNTVNGRRWTNVLLA-INVIMYIAQI---------------ASDGKVLTW 154

  Fly   221 -LFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGS- 283
             ..|.:..:|.:.||..:...:|...||||:|......:|...|.:....|...|||...:|.. 
plant   155 GAKINSLIERGQLWRLATASVLHANPMHLMINCYSLNSIGPTAESLGGPKRFLAVYLTSAVAKPI 219

  Fly   284 ---MGTSLT-----SPRIFLAGASGGVYALITAHIATIIMNYSEME-------YAIVQLLAFLVF 333
               :|::::     :|.:   ||||.::.|: ..:|..::.:.:|.       ..|.|::|.   
plant   220 LRVLGSAMSYWFNKAPSV---GASGAIFGLV-GSVAVFVIRHKQMVRGGNEDLMQIAQIIAL--- 277

  Fly   334 CFTDLGTSVYRHLTDQHDQIGYVAHLSGAVA 364
               ::...:   ::.:.|..|::..|.|..|
plant   278 ---NMAMGL---MSRRIDNWGHIGGLLGGTA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 11/39 (28%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 33/155 (21%)
RBL10NP_173900.2 Rhomboid 161..309 CDD:279958 33/155 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.