DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RBL6

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001184975.1 Gene:RBL6 / 837831 AraportID:AT1G12750 Length:307 Species:Arabidopsis thaliana


Alignment Length:193 Identity:50/193 - (25%)
Similarity:92/193 - (47%) Gaps:28/193 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 EGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFL 295
            |.||.::.|::|.||:||:||:...|..||.||....:.|:||:||.....||:.::|...:...
plant    96 EKWRLITAMWLHAGIIHLVMNMFDVIIFGIRLEQQFGFIRIGLIYLISGFGGSILSALFLQKSIS 160

  Fly   296 AGASGGVYALITAHIATIIMNYSEMEYAIVQLLAFLVFCFTDLGTSVYRHLTDQHDQIGYVAHLS 360
            .||||.:..|:.|.::.::.|::..:..:..||:||.....:|...:.       ..:...||:.
plant   161 VGASGALLGLMGAMLSELLTNWTIYKSKLCALLSFLFIIAINLAIGLL-------PWVDNFAHIG 218

  Fly   361 GAVAGLLVGIGVLRNLEVRRWER--------------------ILWWVAVIVYFALMTTGIII 403
            |.:.|..:|..:|...: ..||.                    :|::||.::..|.:|.|:::
plant   219 GLLTGFCLGFILLMQPQ-SGWEEFRNSSQYGARARSKYNPCQYVLFFVAAVLVVAGLTVGLVM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 41/142 (29%)
RBL6NP_001184975.1 Rhomboid 92..232 CDD:279958 41/142 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.