DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RBL3

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_196342.1 Gene:RBL3 / 830616 AraportID:AT5G07250 Length:346 Species:Arabidopsis thaliana


Alignment Length:296 Identity:61/296 - (20%)
Similarity:121/296 - (40%) Gaps:79/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 ICPPPLTMVL----------------------FSIIEIIMFLVDVIHFQDDPNYQDR-------- 209
            |.||||.:.|                      |.:..:.:|:| .:...:.||:.:.        
plant    29 IGPPPLPVALSSSTEFGDNALSSRWTSWLVPMFVVANVAVFVV-AMFVNNCPNHFESHRLRGHCV 92

  Fly   210 ---IGESTSGPAATLFIYNP----------------YKRYEGWRFVSYMFVHVGIMHLMMNLIIQ 255
               :|..:..|..|..::.|                .::.||||.::.:::|.|::||..|::..
plant    93 AKFLGRLSFEPLRTNPLFGPSSHTLEKLGALEWSKVVEKKEGWRLLTCIWLHAGVIHLGANMLSL 157

  Fly   256 IFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEM 320
            :|:||.||....:.|:|::||...:.||:.:||........||||.::.|:.:.::.:..|::..
plant   158 VFIGIRLEQQFGFVRIGVIYLLSGIGGSVLSSLFIRNSISVGASGALFGLLGSMLSELFTNWTIY 222

  Fly   321 EYAIVQLLAFLVFCFTDLGTSVYRHLTDQHDQIGYVAHLSGAVAGLLVGI--------------- 370
            ...|..||..|.....:|...:..|:.:       .||:.|.|.|.|:|.               
plant   223 SNKIAALLTLLFVILINLAIGILPHVDN-------FAHVGGFVTGFLLGFILLARPQFKWLAREH 280

  Fly   371 ---GVLRNLEVRRWERILWWVAVIVYFALMTTGIII 403
               |.....:.:.::.:||.::::    |:..|.::
plant   281 MPQGTPLRYKYKTYQYLLWLLSLV----LLIAGFVV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 9/43 (21%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 43/181 (24%)
RBL3NP_196342.1 Rhomboid 128..269 CDD:396315 41/147 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.