DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RBL7

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_194038.1 Gene:RBL7 / 828406 AraportID:AT4G23070 Length:313 Species:Arabidopsis thaliana


Alignment Length:261 Identity:63/261 - (24%)
Similarity:115/261 - (44%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 IIEIIMFLVDVIHFQDDPNYQDR-------------------IGESTS-----GPAATLFIYNPY 227
            |..:::|:| |:::.|.|:...|                   :|.|:|     |..|...|.  :
plant    39 IANVVVFVV-VMYYNDCPHKSHRCLAKFLGRFSFESFKSNPLLGPSSSTLEKMGALAWGKIV--H 100

  Fly   228 KRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPR 292
            || :.||.::.|::|.|::||:.|:....::|:.||....:.|||.:||.....||:.:.|....
plant   101 KR-QVWRLLTCMWLHAGVIHLLANMCCVAYIGVRLEQQFGFVRVGTIYLVSGFCGSILSCLFLED 164

  Fly   293 IFLAGASGGVYALITAHIATIIMNYSEMEYAIVQLLAFLVFCFTDLGTSVYRHLTDQHDQIGYVA 357
            ....|||..::.|:.|.::.:::|::..:...|.::..||....:||....       ..:...|
plant   165 AISVGASSALFGLLGAMLSELLINWTTYDNKGVAIVMLLVIVGVNLGLGTL-------PPVDNFA 222

  Fly   358 HLSGAVAGLLVGIGVLRNLEVRRWER--------------------ILWWVAVIVYFALMTTGII 402
            |:.|...|.|:|..:|.:.:. .||.                    :|..||.||:.|..|:|::
plant   223 HIGGFFGGFLLGFLLLIHPQF-EWEENQVSLMPGTIVKPKYNTCQLVLCIVASIVFVAGFTSGLV 286

  Fly   403 I 403
            |
plant   287 I 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 3/9 (33%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 38/147 (26%)
RBL7NP_194038.1 Rhomboid 98..224 CDD:396315 34/135 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.