DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RHBDF2

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_078875.4 Gene:RHBDF2 / 79651 HGNCID:20788 Length:856 Species:Homo sapiens


Alignment Length:199 Identity:38/199 - (19%)
Similarity:90/199 - (45%) Gaps:17/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLT 289
            ||....:.:|....:|:|.|::|.:::::.|:.:...||.:..|.|:.::::...:.|::.:::.
Human   647 NPEVPDQFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIF 711

  Fly   290 SPRIFLAGASGGVYALITAHIATIIMNYSEME---YAIVQLLAFLVFCFTDLGTSVYRHLTDQHD 351
            .|.....|.:|..:.|:......:..::..:|   .|.:.|.|.::|.|          :.....
Human   712 LPYRAEVGPAGSQFGLLACLFVELFQSWPLLERPWKAFLNLSAIVLFLF----------ICGLLP 766

  Fly   352 QIGYVAHLSGAVAGLLVGIGVLRNLEV----RRWERILWWVAVIVYFALMTTGIIIHVFVPDYFP 412
            .|..:||:.|.::|||:....|..:..    :..:|.|..|:::.:..|....::.....|..:|
Human   767 WIDNIAHIFGFLSGLLLAFAFLPYITFGTSDKYRKRALILVSLLAFAGLFAALVLWLYIYPINWP 831

  Fly   413 KQEY 416
            ..|:
Human   832 WIEH 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 29/150 (19%)
RHBDF2NP_078875.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Rhomboid_SP 128..334 CDD:289371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..184
Involved in interaction with FRMD8. /evidence=ECO:0000269|PubMed:29897333 191..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..553
Rhomboid 648..789 CDD:279958 29/150 (19%)
GtrA 748..832 CDD:303012 18/93 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.