Sequence 1: | NP_525084.1 | Gene: | rho-4 / 32109 | FlyBaseID: | FBgn0030318 | Length: | 417 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_078875.4 | Gene: | RHBDF2 / 79651 | HGNCID: | 20788 | Length: | 856 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 38/199 - (19%) |
---|---|---|---|
Similarity: | 90/199 - (45%) | Gaps: | 17/199 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 225 NPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLT 289
Fly 290 SPRIFLAGASGGVYALITAHIATIIMNYSEME---YAIVQLLAFLVFCFTDLGTSVYRHLTDQHD 351
Fly 352 QIGYVAHLSGAVAGLLVGIGVLRNLEV----RRWERILWWVAVIVYFALMTTGIIIHVFVPDYFP 412
Fly 413 KQEY 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-4 | NP_525084.1 | EFh_HEF | <57..197 | CDD:355006 | |
EFh | 73..134 | CDD:238008 | |||
Rhomboid | 226..374 | CDD:396315 | 29/150 (19%) | ||
RHBDF2 | NP_078875.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..115 | ||
Rhomboid_SP | 128..334 | CDD:289371 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..184 | ||||
Involved in interaction with FRMD8. /evidence=ECO:0000269|PubMed:29897333 | 191..271 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 531..553 | ||||
Rhomboid | 648..789 | CDD:279958 | 29/150 (19%) | ||
GtrA | 748..832 | CDD:303012 | 18/93 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1253228at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X418 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |