DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RHBDF1

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_006720984.1 Gene:RHBDF1 / 64285 HGNCID:20561 Length:878 Species:Homo sapiens


Alignment Length:220 Identity:44/220 - (20%)
Similarity:94/220 - (42%) Gaps:29/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVDVIHFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFL 258
            |...:|..||             ....|...||....:.:|....:|:|.||:|.::::..|:.:
Human   651 LCSQVHCMDD-------------VCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTV 702

  Fly   259 GIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEME-- 321
            ...||.:..|.|:.::||...:.|::.:::..|.....|.:|..:.::......:..::..:.  
Human   703 LRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARP 767

  Fly   322 -YAIVQLLAFLVFCFTDLGTSVYRHLTDQHDQIGYVAHLSGAVAGLLVGIGVLRNLEVRRWERIL 385
             .|..:|||.::|.|| .|...:         |...||:||.::||.:....|..:...:::...
Human   768 WRAFFKLLAVVLFLFT-FGLLPW---------IDNFAHISGFISGLFLSFAFLPYISFGKFDLYR 822

  Fly   386 WWVAVIVY---FALMTTGIIIHVFV 407
            ....:|::   |..:..|:::..:|
Human   823 KRCQIIIFQVVFLGLLAGLVVLFYV 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 1/2 (50%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 33/150 (22%)
RHBDF1XP_006720984.1 Rhomboid_SP 114..331 CDD:403706
Rhomboid 670..811 CDD:396315 33/150 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.