DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and rhbdf1b

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_021328201.1 Gene:rhbdf1b / 563403 ZFINID:ZDB-GENE-130531-6 Length:894 Species:Danio rerio


Alignment Length:267 Identity:43/267 - (16%)
Similarity:100/267 - (37%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 YCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFLVDVIHFQDDPNYQDRIGES 213
            ||.::            .|.:.::.::|                   ..:|..||          
Zfish   653 YCDFM------------KGYFHEEATLC-------------------SQVHCMDD---------- 676

  Fly   214 TSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAG 278
               ....|...||....:.:|....:|:|.||:|.::::..|:.:...||.:..|.|:.::|:..
Zfish   677 ---VCGLLPFLNPEIPDQFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILS 738

  Fly   279 VLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEME---YAIVQLLAFLVFCFTDLGT 340
            .:.|::.:::..|.....|.:|..:.::......:..::..:.   .|..:|...::|.|. .|.
Zfish   739 GITGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFTKLSCVVLFLFA-FGL 802

  Fly   341 SVYRHLTDQHDQIGYVAHLSGAVAGLLVGIGVLRNLEVRRWE----RILWWVAVIVYFALMTTGI 401
            ..:         |...||:.|.|:|..:....|..:...|.:    |:...||:.::..:.::.:
Zfish   803 LPW---------IDNFAHICGFVSGFFLSFAFLPYISFGRMDMYRKRLQILVALTLFVGIFSSFV 858

  Fly   402 IIHVFVP 408
            ::....|
Zfish   859 VLFYVYP 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 4/47 (9%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 28/150 (19%)
rhbdf1bXP_021328201.1 Rhomboid_SP 130..348 CDD:315299
Rhomboid 686..829 CDD:307698 29/152 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.