DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RHBDL2

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001291675.1 Gene:RHBDL2 / 54933 HGNCID:16083 Length:383 Species:Homo sapiens


Alignment Length:404 Identity:114/404 - (28%)
Similarity:191/404 - (47%) Gaps:89/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QLQQQRDVENGLYPTIPAERRSPPS----RPQTLRQ-DTIDMEEIPLN--QTNSQEPEDRRKMHE 76
            |.:::|..|:...|.:|.:  |.||    .|:|:.. ..::||.:.||  :...:|.|:..||.|
Human    50 QPREERQPEDLGPPAVPWD--SCPSGEEGGPRTMAAVHDLEMESMNLNMGREMKEELEEEEKMRE 112

  Fly    77 IFDKHDSDRDGLINTHELKELISDGYCRDIPAYIADQILKRSDQDNDGHLDFEEFYAMSLRHKWM 141
              |....||   ..:.::..::|                                       |||
Human   113 --DGGGKDR---AKSKKVHRIVS---------------------------------------KWM 133

  Fly   142 VRNMLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFLVDVIHFQDDPNY 206
            :             |.|      ..|.|.::.:..|||:.::..|:.|:.:|:...:.   .|..
Human   134 L-------------PEK------SRGTYLERANCFPPPVFIISISLAELAVFIYYAVW---KPQK 176

  Fly   207 Q----DRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHH 267
            |    |      :|...:.|||:|.||.|.|||:|||.||.|:.|::.||.:|:.|||.||:||.
Human   177 QWITLD------TGILESPFIYSPEKREEAWRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHK 235

  Fly   268 WWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEM--EYAIVQLLAF 330
            ..||||||||||:|||:.:|:..|..:|.|||||||||:..:...:::|:.||  .:.|.:||..
Human   236 GLRVGLVYLAGVIAGSLASSIFDPLRYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLII 300

  Fly   331 LVFCFTDLGTSVYRH--LTDQHDQIGYVAHLSGAVAGLLVGIGVLRNLEVRRWERILWWVAVIVY 393
            ::....|:|.::||.  :.:....:.:.||::|..||:.:|..|....:....:...:|:|:..|
Human   301 ILIIVLDMGFALYRRFFVPEDGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAY 365

  Fly   394 FALMTTGIIIHVFV 407
            .|.:...:..::|:
Human   366 LACVLFAVFFNIFL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 24/141 (17%)
EFh 73..134 CDD:238008 7/60 (12%)
Rhomboid 226..374 CDD:396315 66/151 (44%)
RHBDL2NP_001291675.1 Rhomboid 194..346 CDD:279958 66/151 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107191
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.