DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and parla

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014320.1 Gene:parla / 541485 ZFINID:ZDB-GENE-050327-8 Length:383 Species:Danio rerio


Alignment Length:199 Identity:43/199 - (21%)
Similarity:72/199 - (36%) Gaps:63/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 FIYNPYKRYEGWRFVSYMFVHVGIMHLMMNL-IIQIFLGIALELVHHWWRVGLVYLAGVLA---- 281
            |..||..:......|...|.|..::|:::|: ::..|....:.|:.....:.|....||::    
Zfish   197 FTSNPASKTRCLPMVLSSFSHYSVIHMVVNMYVLWTFSSSIVSLLGREQFLALYLSGGVISTFVS 261

  Fly   282 -------GSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEMEYAIVQL------------ 327
                   |.:|.||        ||||.:..:    :|.:.....|.:..||.|            
Zfish   262 YVFKTATGRLGPSL--------GASGSIMTV----LAAVCTKIPEAKLGIVLLPVISFSAGNALK 314

  Fly   328 ------LAFLVFCFTDLGTSVYRHLTDQHDQIGYVAHLSGAVAGL-LVGIG---VLRNLE--VRR 380
                  :|.||     ||...:.|          .|||.||:.|: .:|.|   :.|..|  ::.
Zfish   315 ALVALDIAGLV-----LGWRFFDH----------AAHLGGALFGVWYIGYGHELIWRKREPLIKF 364

  Fly   381 WERI 384
            |..:
Zfish   365 WHEL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 38/181 (21%)
parlaNP_001014320.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..75
Rhomboid 210..347 CDD:279958 35/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.