DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and stet

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster


Alignment Length:413 Identity:128/413 - (30%)
Similarity:207/413 - (50%) Gaps:80/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DMEEIPLNQTNSQEPEDRR-----KMHEIFDKHDSDRDGLINTHE-LKELISDGYCRDIPAYIAD 112
            |.|...|| ::..|.|.||     |...:||..|.:..|.|:..| |:.|.|..:...:|....:
  Fly    66 DTEHTSLN-SDFDEAELRRELLRDKWKLLFDMFDPEGFGEISVEEFLEALKSPEFLSQVPMNKRE 129

  Fly   113 QILKRSDQ----DNDGHLDFEEF----------------------------YAMSLRHKWMVRNM 145
            .:|:|:.:    ...|::.|::|                            :.:.|....:.|.|
  Fly   130 LLLERAKKAKLPTGPGYVTFQDFVNVMSGKRTRSFKCAVHHRDREVCSENDFQLVLNEPPLFRKM 194

  Fly   146 LTRYCRYVVPPPKPLEGDEPDGA-YEKQMSICPPPLTMVLFSIIEIIMFLVDVIHFQDDPNYQDR 209
            :......::|       :|.|.. |..:.:.||||..::|.:::|:..|:           |...
  Fly   195 VHAVAMEILP-------EERDRKYYADRYTCCPPPFFIILVTLVELGFFV-----------YHSV 241

  Fly   210 I-GESTSG---PAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWR 270
            : ||:...   |:.::|||.|.||:|.|||:.||.:|.|.:||..|:.:|:..|:.||:||...|
  Fly   242 VTGEAAPRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTR 306

  Fly   271 VGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEMEYAIVQLLAFLVFCF 335
            :..:|.:||||||:|||:..|.:||.|||||||||:.||:|.:::||.:|.|.:::||..|||..
  Fly   307 IACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVS 371

  Fly   336 TDLGTSVYRHLTDQHDQIG------------------YVAHLSGAVAGLLVGIGVLRNLEVRRWE 382
            .|.|.::|........|:|                  |||||:||:|||.:|:.||::.|.:..|
  Fly   372 FDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHE 436

  Fly   383 RILWWVAVIVYFALMTTGIIIHV 405
            ::|||:|:..|.||:...|..::
  Fly   437 QLLWWIALGTYLALVVFAIAFNI 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 36/178 (20%)
EFh 73..134 CDD:238008 16/93 (17%)
Rhomboid 226..374 CDD:396315 72/165 (44%)
stetNP_788450.1 EFh <75..115 CDD:298682 12/39 (31%)
EF-hand_7 91..156 CDD:290234 15/64 (23%)
Rhomboid 262..428 CDD:279958 72/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102232at50557
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.