DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and Rhbdf2

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001100537.2 Gene:Rhbdf2 / 303690 RGDID:1309699 Length:825 Species:Rattus norvegicus


Alignment Length:392 Identity:69/392 - (17%)
Similarity:149/392 - (38%) Gaps:88/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QTLRQDTIDMEEIPLNQTNSQEPEDRRKMHEIFDKHDSDRDGLINTHE----LKELISDGYCRDI 106
            |||::|..:.....:...|..||.|:..:.:       .:...:..|:    .:|..|.|     
  Rat   480 QTLKKDCSETLATFVKWQNDTEPSDKSDLSQ-------KQPSAVVCHQDPRTCEEPASSG----- 532

  Fly   107 PAYI-ADQILK------RSDQDNDG--HLDFE-EFYAMSLRHKWMVRNMLTRYCRYVVPPPKPLE 161
             |:| .|.|.|      ::..:..|  |:|.: :.....:..|.........||.::        
  Rat   533 -AHIWPDDITKWPICTEQAQSNRTGLLHIDCKIKGRPCCIGTKGSCEITTREYCEFM-------- 588

  Fly   162 GDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFLVDVIHFQDDPNYQDRIGESTSGPAATLFIYNP 226
                .|.:.::.::|..  ...|..:..::.||        :|...|:.                
  Rat   589 ----HGYFHEEATLCSQ--VHCLDEVCGLLPFL--------NPEIPDQF---------------- 623

  Fly   227 YKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSP 291
               |..|   ..:|:|.||:|.:::::.|:.:...||.:..|.|:.::::...:.|::.:::..|
  Rat   624 ---YRIW---LSLFLHAGIVHCLVSVVFQMTILRDLEKLAGWHRISIIFILSGITGNLASAIFLP 682

  Fly   292 RIFLAGASGGVYALITAHIATIIMNYSEME---YAIVQLLAFLVFCFTDLGTSVYRHLTDQHDQI 353
            .....|.:|..:.|:......:..::..:|   .|...|.|.::|.|          :......|
  Rat   683 YRAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFNLSAIVLFLF----------ICGLLPWI 737

  Fly   354 GYVAHLSGAVAGLLVGIGVLRNLEV----RRWERILWWVAVIVYFALMTTGIIIHVFVPDYFPKQ 414
            ..:||:.|.::|:|:....|..:..    |..::.|..|:::|:..|..:.::.....|..:|..
  Rat   738 DNIAHIFGFLSGMLLAFAFLPYITFGTSDRYRKQALILVSLLVFAGLFASLVLWLYIYPINWPWI 802

  Fly   415 EY 416
            ||
  Rat   803 EY 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 24/153 (16%)
EFh 73..134 CDD:238008 12/74 (16%)
Rhomboid 226..374 CDD:396315 29/150 (19%)
Rhbdf2NP_001100537.2 Rhomboid_SP 98..302 CDD:403706
Rhomboid 617..758 CDD:396315 31/172 (18%)
MFS 718..>808 CDD:421695 20/97 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.