DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and Rhbdl2

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_038965543.1 Gene:Rhbdl2 / 298512 RGDID:1308295 Length:302 Species:Rattus norvegicus


Alignment Length:363 Identity:106/363 - (29%)
Similarity:171/363 - (47%) Gaps:79/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IDMEEIPLNQTNSQEPEDRRKMHEIFDKHDSDRDGLINTHELKELISDGYCRDIPAYIADQILKR 117
            ::||.:.||    .|.|.:.::.|                  :::..||..:|.|          
  Rat     7 MEMESVNLN----MEREGKEELEE------------------EKMRGDGEGKDFP---------- 39

  Fly   118 SDQDNDGHLDFEEFYAMSLRHKWMVRNMLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTM 182
              :....|         .:..|||:              |:|:.     ..|.::.:..||||.:
  Rat    40 --RGRKVH---------RIVSKWML--------------PEPVR-----RTYLERANCLPPPLFI 74

  Fly   183 VLFSIIEIIMFLVDVIHFQDDPNYQ----DRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHV 243
            ||.|:.|:.:|:...:.   .|..|    |      :|...:...|.|.||.|.|||:|||.||.
  Rat    75 VLISLAELAVFIYYAVW---KPQKQWITLD------TGILESPLTYRPEKREEAWRFISYMLVHA 130

  Fly   244 GIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITA 308
            |:.|::.||.:|:.|||.||:||...||||||||||||||:.:|:..|...|.|||||||||:..
  Rat   131 GVQHIVGNLFMQLVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGASGGVYALMGG 195

  Fly   309 HIATIIMNYSEM--EYAIVQLLAFLVFCFTDLGTSVYRH--LTDQHDQIGYVAHLSGAVAGLLVG 369
            :...:|:|:.||  ...||:||..::...:|:|.::||.  :......:.:.||::|..||:.||
  Rat   196 YFMNVIVNFREMIPALGIVRLLVIILIVASDMGFALYRRFFVPANGSPVSFAAHIAGGFAGMSVG 260

  Fly   370 IGVLRNLEVRRWERILWWVAVIVYFALMTTGIIIHVFV 407
            ..|....:....:...:|:::..|.|.:...:..::|:
  Rat   261 YTVFSCFDKTLLKDPRFWISIAAYVACLLFAVFFNIFL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 25/139 (18%)
EFh 73..134 CDD:238008 6/60 (10%)
Rhomboid 226..374 CDD:396315 70/151 (46%)
Rhbdl2XP_038965543.1 Rhomboid 113..265 CDD:396315 70/151 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107191
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.