DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and Rhbdl3

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_006533389.1 Gene:Rhbdl3 / 246104 MGIID:2179276 Length:433 Species:Mus musculus


Alignment Length:278 Identity:71/278 - (25%)
Similarity:123/278 - (44%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ERRSP-PSRPQTLRQDTIDMEEIPLNQTNSQEPEDRRKMHEIFDKHDSDRDGLINTHELKELISD 100
            |..|| |:.......:.|:..|....:.....|||..|:  :|:|.|....|.|:|.:.:.|: :
Mouse     3 EHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKV--LFEKFDPGSTGYISTGKFRSLL-E 64

  Fly   101 GYCRDIPAYIADQILKRSDQDNDGHLDFEEFYAM-------SLRHKWMVRN-------------- 144
            .:...:..:..:.:|..:|...||.:.:::|..:       |.|...:..|              
Mouse    65 SHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSSKALLEEKGL 129

  Fly   145 -MLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFL----------VDVI 198
             :..|..|:|.....|.|.|..  .|....:.||||..|:..:::|:.:||          :.|.
Mouse   130 SLSQRLIRHVAYETLPREIDRK--WYYDSYTCCPPPWFMITITLLEVALFLYNGVLLDQFVLQVT 192

  Fly   199 HFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALE 263
            |    |.|           .....:|:|..|.:.||:|:|:|:|.|:..|.:|:.:|:.:|:.||
Mouse   193 H----PRY-----------LKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVPLE 242

  Fly   264 LVHHWWRVGLVYLAGVLA 281
            :||...|:||||:|||:|
Mouse   243 MVHGATRIGLVYVAGVVA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 35/171 (20%)
EFh 73..134 CDD:238008 13/60 (22%)
Rhomboid 226..374 CDD:396315 26/56 (46%)
Rhbdl3XP_006533389.1 EF-hand_7 36..100 CDD:372618 15/66 (23%)
Rhomboid 207..>260 CDD:389796 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4661
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.