DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and Rhbdf2

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_030101763.1 Gene:Rhbdf2 / 217344 MGIID:2442473 Length:853 Species:Mus musculus


Alignment Length:424 Identity:74/424 - (17%)
Similarity:163/424 - (38%) Gaps:93/424 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QQLQ--LQQQRDVENGLYPTIPAERRSPPSRPQTLRQDTIDMEEIPLNQTNSQEPEDRRKMHEIF 78
            ||::  ::::||:|......:..:|   ....|||::|..:.....:...|...|.|:..:.:  
Mouse   479 QQIEQLVRRERDIERTSGCCVQNDR---SGCIQTLKKDCSETLATFVKWQNDTGPSDKSDLSQ-- 538

  Fly    79 DKHDSDRDGLINTHE----LKELISDGYCRDIPAYI-ADQILK------RSDQDNDG--HLDFE- 129
                 .:...:..|:    .:|..|.|      |:| .|.|.|      ::..::.|  |:|.: 
Mouse   539 -----KQPSAVVCHQDPRTCEEPASSG------AHIWPDDITKWPICTEQAQSNHTGLLHIDCKI 592

  Fly   130 EFYAMSLRHKWMVRNMLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFL 194
            :.....:..|.........||.::            .|.:.:..::|..  ...|..:..::.||
Mouse   593 KGRPCCIGTKGSCEITTREYCEFM------------HGYFHEDATLCSQ--VHCLDKVCGLLPFL 643

  Fly   195 VDVIHFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLG 259
                    :|...|:.                   |..|   ..:|:|.||:|.:::::.|:.:.
Mouse   644 --------NPEVPDQF-------------------YRIW---LSLFLHAGIVHCLVSVVFQMTIL 678

  Fly   260 IALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEME--- 321
            ..||.:..|.|:.::::...:.|::.:::..|.....|.:|..:.|:......:..::..:|   
Mouse   679 RDLEKLAGWHRISIIFILSGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWQLLERPW 743

  Fly   322 YAIVQLLAFLVFCFTDLGTSVYRHLTDQHDQIGYVAHLSGAVAGLLVGIGVLRNLEV----RRWE 382
            .|...|.|.::|.|          :......|..:||:.|.::|:|:....|..:..    :..:
Mouse   744 KAFFNLSAIVLFLF----------ICGLLPWIDNIAHIFGFLSGMLLAFAFLPYITFGTSDKYRK 798

  Fly   383 RILWWVAVIVYFALMTTGIIIHVFVPDYFPKQEY 416
            |.|..|:::|:..|..:.::.....|..:|..||
Mouse   799 RALILVSLLVFAGLFASLVLWLYIYPINWPWIEY 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 23/153 (15%)
EFh 73..134 CDD:238008 12/74 (16%)
Rhomboid 226..374 CDD:396315 29/150 (19%)
Rhbdf2XP_030101763.1 Rhomboid_SP 98..328 CDD:372211
Rhomboid 648..788 CDD:366759 31/171 (18%)
MFS 746..>836 CDD:391944 20/97 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.