DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and RHBDL3

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001350764.1 Gene:RHBDL3 / 162494 HGNCID:16502 Length:428 Species:Homo sapiens


Alignment Length:278 Identity:72/278 - (25%)
Similarity:125/278 - (44%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ERRSP-PSRPQTLRQDTIDMEEIPLNQTNSQEPEDRRKMHEIFDKHDSDRDGLINTHELKELISD 100
            |..|| |:.......:.|:..|....:.....|||..|:  :||:.|....|.|:|.:.:.|: :
Human     3 EHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKV--LFDQFDPGNTGYISTGKFRSLL-E 64

  Fly   101 GYCRDIPAYIADQILKRSDQDNDGHLDFEEFYAM-------SLRHKWMVRN-------------- 144
            .:...:..:..:.:|..:|...||.:.:::|.::       |.|...:..|              
Human    65 SHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNSFRQAILQGNRRLSSKALLEEKGL 129

  Fly   145 -MLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMFL----------VDVI 198
             :..|..|:|.....|.|.|..  .|....:.||||..|:..:::|:..||          :.|.
Human   130 SLSQRLIRHVAYETLPREIDRK--WYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVT 192

  Fly   199 HFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFLGIALE 263
            |    |.|           .....:|:|..|.:.||:::|:|:|.||.||.:|:::|:.:|:.||
Human   193 H----PRY-----------LKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQLLVGVPLE 242

  Fly   264 LVHHWWRVGLVYLAGVLA 281
            :||...|:||||:|||:|
Human   243 MVHGATRIGLVYVAGVVA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 35/171 (20%)
EFh 73..134 CDD:238008 13/60 (22%)
Rhomboid 226..374 CDD:396315 27/56 (48%)
RHBDL3NP_001350764.1 EF-hand_7 36..100 CDD:316058 15/66 (23%)
EF-hand motif 38..67 CDD:320054 8/31 (26%)
Rhomboid 205..>260 CDD:328780 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.