DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and Rhbdf1

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_036012182.1 Gene:Rhbdf1 / 13650 MGIID:104328 Length:926 Species:Mus musculus


Alignment Length:98 Identity:22/98 - (22%)
Similarity:44/98 - (44%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVDVIHFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFL 258
            |...:|..||             ....|...||....:.:|....:|:|.||:|.::::..|:.:
Mouse   677 LCSQVHCMDD-------------VCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTV 728

  Fly   259 GIALELVHHWWRVGLVYLAGVLAGSMGTSLTSP 291
            ...||.:..|.|:.::||...:.|::.:::..|
Mouse   729 LRDLEKLAGWHRIAIIYLLSGITGNLASAIFLP 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 1/2 (50%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 16/66 (24%)
Rhbdf1XP_036012182.1 Rhomboid_SP 139..356 CDD:403706
Rhomboid 696..>762 CDD:419717 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.