DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and Rhbdf1

DIOPT Version :10

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_036012182.1 Gene:Rhbdf1 / 13650 MGIID:104328 Length:926 Species:Mus musculus


Alignment Length:98 Identity:22/98 - (22%)
Similarity:44/98 - (44%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVDVIHFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQIFL 258
            |...:|..||             ....|...||....:.:|....:|:|.||:|.::::..|:.:
Mouse   677 LCSQVHCMDD-------------VCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTV 728

  Fly   259 GIALELVHHWWRVGLVYLAGVLAGSMGTSLTSP 291
            ...||.:..|.|:.::||...:.|::.:::..|
Mouse   729 LRDLEKLAGWHRIAIIYLLSGITGNLASAIFLP 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 FRQ1 <49..131 CDD:444056
Rhomboid 226..374 CDD:426384 16/66 (24%)
Rhbdf1XP_036012182.1 Rhomboid_SP 139..333 CDD:463639
Rhomboid 696..>762 CDD:451297 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.