DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-4 and rhbdl3

DIOPT Version :9

Sequence 1:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_031750644.1 Gene:rhbdl3 / 101732375 -ID:- Length:350 Species:Xenopus tropicalis


Alignment Length:288 Identity:94/288 - (32%)
Similarity:154/288 - (53%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LRHKWMVR----NMLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPPPLTMVLFSIIEIIMF--- 193
            ||:|.::.    ::..|:.|::.....|.|.|. ...|:.... ||||..::..:|:|:..|   
 Frog    59 LRNKALLEESGLSLTQRFIRHMAYETLPREIDR-KWFYDNYTG-CPPPWFIITVTIVEVAAFVYY 121

  Fly   194 --LVDVIHFQ-DDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHVGIMHLMMNLIIQ 255
              ::|....| ..|.|      ..:.|    .:|:|..|.:.||::||||:|.||.||.:|:.:|
 Frog   122 GLVLDRFVLQATHPRY------LRNNP----LVYHPQVRVQAWRYLSYMFMHAGIEHLGVNVALQ 176

  Fly   256 IFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITAHIATIIMNYSEM 320
            :.:|:.||:||...|:..||:||:||||:..|:........|||.|||||::||:|.|:||:|.|
 Frog   177 LLVGVPLEMVHGAVRISFVYIAGILAGSLAVSVADTSAPAVGASAGVYALLSAHLANIVMNWSGM 241

  Fly   321 EYAIVQL-LAFLVFCFT-DLGTSVYRHLTDQ------HDQIGYVAHLSGAVAGLLVGIGVLRNLE 377
            :.....| .||.:.|.: :.|.:|:..|...      |.  .:||||.|.:.|:.:|:..|||.|
 Frog   242 KCQFKLLRTAFALICMSFEFGRAVWLRLYPSAYAPCPHP--SFVAHLGGVLVGITLGVITLRNYE 304

  Fly   378 VRRWERILWWVAVIVYFALMTTGIIIHV 405
            .|..::.||||.:.:|...:|..::.::
 Frog   305 QRLRDQSLWWVFLAIYVLFVTFAVLWNI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 16/69 (23%)
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 61/155 (39%)
rhbdl3XP_031750644.1 Rhomboid 152..301 CDD:396315 59/150 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.