DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and pkdc

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:291 Identity:63/291 - (21%)
Similarity:110/291 - (37%) Gaps:77/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 GVVWRLQAASDSKRSLVVK--LPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGD 325
            |.:.|:......:.|:|||  :.|||:.....:.......|:..:|:|        :..|     
Zfish    32 GEIIRVHLEGCDRPSVVVKHVMFPQNQKHPGGWNTDISHQRKVRSYQV--------ETYW----- 83

  Fly   326 DRFRQHA--------LCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHA 382
              ::.:.        ||...:.....:.||||||..|||.:...:::.:  .::..:...|..||
Zfish    84 --YQNYTTNENCRVPLCLAAKSFGEEQLIVLEDLDVAGFPVRKTYVNDA--EIKACLSWIANFHA 144

  Fly   383 ISLAGKRQLPEKMQQLQQLVDIFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFAR 447
            :.|   ...||.:                ..:|.|:.  .|:....|.|.:|.    :|:|  |.
Zfish   145 LFL---DVTPEGL----------------WPIGTYWH--LETRPEELEAMSDQ----KLKA--AA 182

  Fly   448 GSYFELLLPLVSGFNCEPFAVICHGD------CWNNNILYKSTERGELEDVRLIDWQLMRYASPV 506
            |....:|      .||. |..|.|||      |::.:.|          .|..:|:|.:.....:
Zfish   183 GEIDSIL------NNCR-FKTIVHGDAKLANFCFSKDGL----------QVASVDFQYVGGGCGM 230

  Fly   507 TDLAYFLFTCTSRRFRQRHLENMLEDYYEEL 537
            .|:.|||.:|...|..::....:|:.|:.||
Zfish   231 KDVIYFLGSCMDERECEKKAPGLLDYYFSEL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 63/291 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D832683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.