DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG10553

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:350 Identity:87/350 - (24%)
Similarity:150/350 - (42%) Gaps:48/350 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 DEDLPNEQVT-------QFLRQLVSQLWPELGANPELRLERASAKGDNYLGVVWRLQA------A 271
            |||:..:|||       ....:|:.::..:..|...:|.....|.|:||..|:.|::.      .
  Fly     7 DEDVSQKQVTIPDWVKPTVFEELLKRIVKDYKATKSMRANAGVAAGENYATVMLRIELDVEKEDN 71

  Fly   272 SDSKRSLVVKLPPQNRVRRKQFFARPCFLRETAAY-EVFLPLTALIQDKWKIIGDDRFRQHALCF 335
            :.:.::.::|.|.|:...||.......|..|...| ||...|..|.:|    :|.:      :.|
  Fly    72 TQTTKAFMLKTPHQSEQYRKVIEKTDIFDVERGMYVEVVPELEQLYRD----VGLE------VKF 126

  Fly   336 GTRQ---DEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAIS---LAGKRQLPEK 394
            |...   :..:..::||||...||...:|...:...|...|:..:|:.||.|   :..|....||
  Fly   127 GAELYDIEASDYYVLLEDLRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEK 191

  Fly   395 ----MQQLQQLVDIFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLL 455
                ..:.:::||.|..|    ::.|:.:|:.       |....:.|...|.  ...|..||::.
  Fly   192 YTKGFLRNEEIVDAFINR----SIKVFLDNVH-------LCKGYETYLNDLR--IVSGKTFEIVE 243

  Fly   456 PLVSGFNCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRR 520
            .| :..:.:.|..:.|||.|.|||:.:...:||::|...:|.|:.::.|...||.|||.:.||..
  Fly   244 SL-NNPSPDEFIALNHGDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLD 307

  Fly   521 FRQRHLENMLEDYYEELGLQLIRLG 545
            .:....:..:..|:.||...|..||
  Fly   308 IKTSKFDYFIWFYHSELVKHLKLLG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 76/305 (25%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 76/304 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.