DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG10559

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:439 Identity:96/439 - (21%)
Similarity:163/439 - (37%) Gaps:126/439 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PELGANPELRLERASAKGDNYLGVVWR------LQAASDSKRSLVVKLP-----PQNRVRRKQFF 294
            ||.|..|          |:||..::.|      ||..:....|.::|.|     .:..:|:...|
  Fly    39 PEAGLKP----------GENYSTIMLRLKLEVELQDHTIENVSYMLKTPYDFEMYREILRKNNMF 93

  Fly   295 ARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFRQHALCFGTRQ---DEPNECIVLEDLSCAGF 356
            |        ...:||:.:...::..:|.:|.:      :.||.:.   |.|::.::|:||...||
  Fly    94 A--------VERDVFIQVIPELEQMYKDVGVE------VKFGAKAYEIDAPDDYVLLQDLGPLGF 144

  Fly   357 SLHNRFLDLSVEHVRRVMLTYAKLHAIS-----LAGKRQLPEKMQQLQQLVDIFEQRRDDHALGV 416
            ...:|...|.:.|.:.|:...|:.||:|     |.|    |.....||.               .
  Fly   145 RNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKG----PYPQNYLQP---------------T 190

  Fly   417 YFENLKES--ALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGF------------------ 461
            |.:.:|||  .::..|                 |.||...|||..|:                  
  Fly   191 YADTMKESIEQVAETL-----------------GKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLM 238

  Fly   462 ------NCEPFAVICHGDCWNNNILYK-STERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSR 519
                  :.:.|..:.|||||.:||::| ..|..|..:...:|.||.:..|...||.|||...|..
  Fly   239 YAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKF 303

  Fly   520 RFRQRHLENMLEDYYEELGLQLIRLGERVEQLFPRPAF-DEQVATKAAVGLLLAMMVLPIVTMQG 583
            ..:....:..::.|::.| ::.:|:....|...|...| ..|:.....||..:|.::.|.|.:  
  Fly   304 EIQLSQFDYFIKYYHDHL-VEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLL-- 365

  Fly   584 QDVPDLQAISERIEAGATTDL-----HGAGF-LGAGNEATFKQRIREVI 626
                      :|.|....||.     :|.|. |...:.|.:|:.:..::
  Fly   366 ----------DRTEDANLTDFVTETDNGDGLKLAMYSNARYKKHVSAIL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 74/334 (22%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 75/345 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.940

Return to query results.
Submit another query.