DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG10550

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:433 Identity:98/433 - (22%)
Similarity:174/433 - (40%) Gaps:81/433 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SPVEQQEDTAKPDEDL--PNEQVTQFLRQLVSQLWPELGANPELRLERASAKGDNYLGVVWR--- 267
            ||....|....|:|.|  |.....::.:.::.:..........|....|:|.|:||..::.|   
  Fly     2 SPNNSAEKPVNPNEHLHIPKWINEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIV 66

  Fly   268 ---LQAASDSKRSLVVKLPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFR 329
               |:..|:.:.|.::|...:.............|.:|...|||.:|....:           ::
  Fly    67 DILLKDGSEQRVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKL-----------YK 120

  Fly   330 QHAL-------CFGTRQDEPNECI--VLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISL 385
            :..|       |.  ..|..:|.|  |.||||...|...:|.....:.|:|.|:...|:|||.|:
  Fly   121 EAGLEIELAPKCL--HVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASV 183

  Fly   386 AGKRQLPEKMQQLQQLVDIFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSY 450
            ..| ::......:..:....||.||      .||:|.:......|....:......|:|.||   
  Fly   184 VAK-EINGPYDAMYNMSIYNEQSRD------LFESLGKQREEQFLKAMRNWDLENAESYIAR--- 238

  Fly   451 FELLLPL--------VSGFNCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVT 507
              :..||        |:..:.:.|.|:.|||||:|||::...:.||::...|:|.|:.::.||..
  Fly   239 --MWDPLEVFEEAVQVNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQ 301

  Fly   508 DLAYFLFTCTSRRFRQRHLENMLEDYYEELG--LQLIRLGERVEQL-----------FPRPAFDE 559
            ||.|.:.|..|...:.:..::.::.|::.|.  |:|:...:.:..|           |..|.   
  Fly   302 DLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPL--- 363

  Fly   560 QVATKAAVGLLLAMMV-------LPIVTMQGQDVPDLQAISER 595
                 .|:|:::|.::       :.::..||   |:..||..|
  Fly   364 -----TAMGVMVATLMPTDKDANMKMILAQG---PEADAIRYR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 76/313 (24%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 76/311 (24%)
APH 108..338 CDD:279908 65/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459845
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.