DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG31370

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:400 Identity:102/400 - (25%)
Similarity:167/400 - (41%) Gaps:82/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 EDTAKPDEDLP---NEQ-VTQFLRQLVSQLWPELGANPELRLER-----ASAKGDNYLGVVWRLQ 269
            ||:.....::|   ||| ||..||....:        |:||:.:     .|||||||..|:.|.:
  Fly     3 EDSLADQLNVPEWLNEQFVTDVLRSHEKE--------PDLRVTKLDFTPGSAKGDNYASVIIRAR 59

  Fly   270 AASDSK-----RSLVVKLPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFR 329
            ....::     :||::|      ...:.|.....|..|...|...||..|.|..:    .:|..|
  Fly    60 VEYITQKGFFSKSLIIK------TVLEMFAGSALFKTEIGMYRKVLPEFARILRE----NNDTSR 114

  Fly   330 QHALCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTY----------AKLHAIS 384
            .:|.|. ....||::.::.|||.           ::....||..:||:          ||.||:|
  Fly   115 LYAECI-YYSLEPSQVMIFEDLG-----------EMDYAMVRDRVLTHGEICGAYSKLAKFHALS 167

  Fly   385 LAGKRQLPEKMQQLQQ---LVDIFEQRRDDHALGVYFENLKESALSALLAPADDAYRV---RLEA 443
            :....:.||.:::.:.   ||||...   ...:|.:.:.|..       .|..|.|:.   ::|.
  Fly   168 MKIINERPEFVKEFKDGICLVDIPYM---SSGMGPFKDFLGR-------IPELDRYKTHFEKIEV 222

  Fly   444 YFARGSYFELLLPLVSGFNCEP---FAVICHGDCWNNNILYK-STERGELEDVRLIDWQLMRYAS 504
            :|     .:.|..::..:...|   :.|:||||....||:.| :.|.|..||..|:|:|.. |.:
  Fly   223 HF-----IDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGC-YVA 281

  Fly   505 PVT-DLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRLGERVEQLFPRPAFDEQVATKAAVG 568
            |:. ||.|.::...:|..|...||.:|..|:..|...|.::|.:.:...| |||.:::.......
  Fly   282 PLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDP-PAFWKEMYRLKDYE 345

  Fly   569 LLLAMMVLPI 578
            .|.....||:
  Fly   346 FLFLSTYLPM 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 79/314 (25%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 79/314 (25%)
APH <202..320 CDD:279908 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.