DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG6834

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:494 Identity:120/494 - (24%)
Similarity:195/494 - (39%) Gaps:111/494 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 APAEQVDQKEAEPDPHEDTEDERNGEVNREH--PDRMESPVEQQEDTAKPD-------EDLPNEQ 227
            |.|..::||:|..:....:..:..|......  |.::..|:|  :....|:       |:|....
  Fly    15 ASAGDLNQKKASINISGSSNAKIKGSTTTADTPPPQLPCPIE--KSNLGPEWLNQTQFEELLAAH 77

  Fly   228 VTQFLRQLVSQLWPELGANPELRLERASAKGDNYLGVVWRLQ---AASDSKRSLV---VKLPPQN 286
            |.||.:.:..|:.|            |.|.|:||..::.|:.   ..:|....||   :|: |.|
  Fly    78 VDQFSKIVGFQVKP------------AMAPGENYATLMLRISIDVELTDKSTKLVCFMLKV-PHN 129

  Fly   287 RVRRKQFFARPCFLR-ETAAYEVFLPLTALIQDKWKIIG-DDRFRQHALCFGTRQDEPN--ECIV 347
            ..:.:|..|...|.. |...|...||   .:::.:|..| |..|...|....:.: ||.  ..::
  Fly   130 VPQMEQMLAMANFFNSENKVYSDILP---KLEELYKAKGLDITFAPKAFKLDSVK-EPKLANTVL 190

  Fly   348 LEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQLVDIFEQRRDDH 412
            :.|||..||...||...|::|..:..:...|:.||.|              ...|.:.....|..
  Fly   191 MSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAAS--------------SMNVQVNGPYEDQF 241

  Fly   413 ALGV----------YFENLKESALSALLA-----PADDAYRVRLEAYFARGSYFELLLPLVSGFN 462
            ..||          ::|.:..|..:||:|     ...:.:|.:||..|.     ::.|.......
  Fly   242 VNGVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFV-----QIFLDFEHLMT 301

  Fly   463 CEP--FAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRH 525
            .:|  |.|:.|||||.||:|:|...:||::|:..:|:|..:|.||..||.|.:.|.....::..:
  Fly   302 ADPDEFNVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDY 366

  Fly   526 LENMLEDYYEELGLQLIRLGERVEQLFPRPAFDE---------QVATKAAVGLLLAMMVLPIVTM 581
            .|..:..|:|:|...|..||...:|    |:..|         ..|...::|      |||||.:
  Fly   367 FEYFIRHYHEQLTQHLDLLGFTGKQ----PSLRELHMLMYKHGSWAVFPSIG------VLPIVLL 421

  Fly   582 QGQDVPDLQAISERIEAGATTDLHGAGFLG-AGNEATFK 619
            .    |:..|..|             .||| :.:.|.||
  Fly   422 D----PNESATFE-------------NFLGDSESSAKFK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 81/315 (26%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 81/315 (26%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459863
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.