DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG6830

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:478 Identity:120/478 - (25%)
Similarity:196/478 - (41%) Gaps:57/478 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 DQKEAEPDPHEDTEDERNGEVNREHPDRMESPVEQQEDTAKPDEDLPNEQVTQFLRQLVSQLWPE 242
            :.||.:.:..:.::.....:||.|.|.....|..:.:.:....:.|...|..:.|...|.|....
  Fly     5 NSKEKQSNEVKTSKQAPKAQVNPEPPAPPNKPEPEVDHSDLVPKWLNQTQFEELLAADVDQFSKI 69

  Fly   243 LGANPELRLERASAKGDNYLGVVWRLQ---AASDSKRSLV---VKLPPQNRVRRKQFFARPCFLR 301
            :|    .|::.|.|.|:||..::.|:.   ..:|....||   :|:|.......:.......|..
  Fly    70 VG----FRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMKVPHDTPQMEQMMSMANFFTS 130

  Fly   302 ETAAYEVFLPLTALIQDKWKIIG-DDRFRQHALCF-GTRQDEPNECIVLEDLSCAGFSLHNRFLD 364
            |.|||...||   .:::.:|..| |.:|...|... .|::.:....:::.||...||...||...
  Fly   131 ENAAYTEILP---KMEELYKAKGLDIKFAPRAFKLDATKEPKVANTVLMHDLGQNGFKNINRLEC 192

  Fly   365 LSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQLVDIF---EQRRDDHALGVYFENLKESAL 426
            |::|..:..:...|:.||   ||...    :|......|||   ....:..|:..:.|.:..|..
  Fly   193 LNLEQTKFALTRLAQFHA---AGATM----VQVHGPYPDIFVNGVMGNNKEAIIAFMEGMLASFR 250

  Fly   427 SALLAPAD-----DAYRVRLEAYFARGSYFELL-LPLVSGFNCEP--FAVICHGDCWNNNILYKS 483
            ::.:|..|     :.||.:||...| |...|.: |.:|     :|  |..:.|||||.||:|:|.
  Fly   251 TSFMANLDKFKNGEEYREKLEKALA-GLTMEFMKLGIV-----DPNEFNALNHGDCWMNNLLFKM 309

  Fly   484 TERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRLGERV 548
            ...|:|||:..:|:|..:|.||..||.||:.:.....::..|.:..:..|.|.|...|..||   
  Fly   310 NSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEALVKHLGILG--- 371

  Fly   549 EQLFP--RPAFDEQVATKAAVG---LLLAMMVLPIVTMQGQDVPDLQAISERIEAGATTDLHGAG 608
               |.  :|:..|...|....|   |...:.|||:|.:.    |...|..:...:.:...:...|
  Fly   372 ---FTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLD----PTQSATFDNFMSDSADGVSFRG 429

  Fly   609 FLGAGNEATFKQRIREVILDCVD 631
            .|.|....   |...|.||..:|
  Fly   430 SLYANKRC---QEYIERILPWLD 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 83/307 (27%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 84/313 (27%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.