DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG11889

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:383 Identity:91/383 - (23%)
Similarity:154/383 - (40%) Gaps:64/383 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ELRLERASAKGDNYLGVVWRLQA---ASDSK--RSLVVKLPPQNRVRRKQFFARP---------- 297
            :|.::.|:|.|:||..|:.|:..   ..|||  :|....|        |..||..          
  Fly    35 KLTIKPATANGENYASVMTRISVEYITKDSKDNQSATFLL--------KTTFADKDPAAHLLINY 91

  Fly   298 -CFLRETAAYEVFLP-LTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECIVLEDLSCAGFSLHN 360
             .:.||...||..|| |..:::::   :.|.| :..|...|.  |...:.|:.||||...:.:..
  Fly    92 GIYTREIDMYEQILPRLADIVKNE---LHDSR-KLFAATVGV--DRERDSIMFEDLSLERYKVAC 150

  Fly   361 RFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQLVDIFEQRRD-----DHALGVYFEN 420
            |...|.:||...|:...|..||...|..::.|          .|||:..|     .|..|  :|.
  Fly   151 RVKKLDLEHTYLVLEKLADFHAAGAALAQRQP----------GIFEKNYDRGFFNKHVRG--YEP 203

  Fly   421 LKESALSALLAPAD------DAYRVRLEAYFAR-GSYFELLLPLVSGFNCEPFAVICHGDCWNNN 478
            :.::.|.||....|      :.|:.:::..... ..|.|....:..|    .|..:.|||.|..|
  Fly   204 IMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPG----DFVTLAHGDIWTTN 264

  Fly   479 ILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEEL--GLQL 541
            ::::..:.|...:...||:|...:.||..||.||..|......|......:::.|:.:|  .|:.
  Fly   265 VMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALER 329

  Fly   542 IRLGERVEQLFPRPAFDEQVATKAAVGLLLAMMVLPIVTMQGQDVPDLQAISERIEAG 599
            ::...:|..||   .|.:|..||....:..:::..|.:...|::.|.::......|.|
  Fly   330 VKYSGKVPSLF---EFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 76/319 (24%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 76/317 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.940

Return to query results.
Submit another query.