DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG16898

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:411 Identity:101/411 - (24%)
Similarity:171/411 - (41%) Gaps:72/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LPNEQVTQFLRQLVSQLWPELGA---NPELRLER-----ASAKGDNYLGVVWRLQAASDSKRSLV 279
            |||....::|:       |:|.|   :.:|::.:     |:.||.||:.::.|:.........|:
  Fly     2 LPNWLTEEYLQ-------PKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLL 59

  Fly   280 VKLPPQNRV------------RRKQFFARPCFLRETAAYEVFLP-LTALIQD---KWKIIGDDRF 328
                 |||.            :.|.|.....:.||...||..|| :..|:|:   ..|...|..|
  Fly    60 -----QNRTYIIKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIF 119

  Fly   329 RQHALCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPE 393
                      .|.....|:||||:...:...:|...|.:.|.:..:...||.||.|:..|::.||
  Fly   120 ----------VDREYRTIILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPE 174

  Fly   394 KMQQLQQLVDIFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLV 458
            .:.: ...:..|.  ||:..    :..:.|..|||.:...:: ..|..:.|   |:..:.:...:
  Fly   175 LLTK-SLFIHCFS--RDNKG----YTEVYEGVLSAFIRFINE-QPVLKKKY---GNKLQKIHENI 228

  Fly   459 SGFNCEPFAV-------ICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTC 516
            ..:....|.|       :.|||||..|.||:..:....:....||:|...:.|||.||..| || 
  Fly   229 MDYGARTFEVGEQELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQF-FT- 291

  Fly   517 TSRRFRQRHLENML-EDYYEELGLQLIRLGERVEQLFPR-PAFDEQVATKAAVGLLLAMMVLPIV 579
            .|.|...:.:|::| |.||.:|...:..|.  .:.:||. ..|.:|..::..: .|||.:..|::
  Fly   292 VSLRDEVQDMESVLVEKYYSDLKTNVDTLS--YKGIFPSLQGFQKQFESRRFM-CLLAHLFKPVI 353

  Fly   580 TMQGQDV-PDLQAISERIEAG 599
            ...|.:| .|..::.:..|.|
  Fly   354 IYDGTEVSSDFSSVYKDTEEG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 79/312 (25%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 79/314 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459593
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.