DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG33510

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:389 Identity:83/389 - (21%)
Similarity:148/389 - (38%) Gaps:80/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 KLPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWK---IIGD-DRFRQH---ALCFGTR 338
            :|..|..|:..:.|.:.... :.|..|.::....||:.:.|   ::.: .:|.:|   |.|:.||
  Fly    67 QLEDQKDVQTSRLFVKSVIF-QNANMEFYMEKMGLIEKEIKLYDLLNELKKFSKHVWSAKCYFTR 130

  Fly   339 QDEPNECIVL---EDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQ 400
            :|    ..|:   ||:.........||  |:...:..::.:.|.|||.|:|.::|          
  Fly   131 KD----LFVMQNVEDMGYVALPPGTRF--LNENQMGPILKSLATLHASSIAYEKQ---------- 179

  Fly   401 LVDIFEQRRDDHALGVYFEN-LKESALSALLAPADDAYRVRLEAYFARGS-------------YF 451
                     ....:||.|.. |||.::.    |..:.|...|.|..|..:             |.
  Fly   180 ---------QGKTIGVEFRKWLKEVSVD----PEVEWYTTGLRAVLAVAAIHPDVLDNPEAQEYI 231

  Fly   452 ELLLP-----LVSGFNCEPF--AVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDL 509
            ...||     :....|..|.  .|..|.|.||.|:.|...:..|...: |:|:||.||:.|..|.
  Fly   232 AQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKPHEERSI-LVDFQLCRYSPPAMDF 295

  Fly   510 AYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRLGER--VEQLFPRPAFDEQVATKAAVGLLLA 572
            ....:.......|::.:.:::|.||:.|..:...:|..  .||| .:..|::.:...:..|....
  Fly   296 HLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQL-SKQEFEQSLNDFSLFGATYN 359

  Fly   573 MMVLPIVTMQGQDVPDLQAISERIEAGATTDLHGAGFLGAGNEATFKQRIR------EVILDCV 630
            .:...::.:....:.:|:  .||.|     |.|  .|......|...:.::      :.:.|||
  Fly   360 CIAATVLRLPDNYLKNLK--DERPE-----DFH--RFCNVDRSADVLRLMKNHPEFADYMYDCV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 66/295 (22%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 50/220 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.