DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG33511

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:351 Identity:85/351 - (24%)
Similarity:142/351 - (40%) Gaps:86/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LPNEQVTQFLRQLVSQLWPELGANPELRLERASAKGD------NYLGVVWRLQAASDSKRSLVVK 281
            |.|.||....:.|:..    :|...:|.|| |..|||      ||                .:..
  Fly    27 LINSQVDAGSKDLMGY----MGEYYKLHLE-AEVKGDKKKYFLNY----------------FIKS 70

  Fly   282 LPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECI 346
            ||.:|..:|::...:..|.:|:|.|...||.......|         :.:..|:.:|    |:.:
  Fly    71 LPRKNEPQREECERKGVFQKESALYSQILPKIQKYATK---------KLYPKCYYSR----NDIL 122

  Fly   347 VLEDLSCAGFSLH-NRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQ--LVD----- 403
            |||||:.....|. |.:..|  :|.:.|:...::|||.|:|.:.:...|:.:..:  |::     
  Fly   123 VLEDLTQDYRHLRANEYYTL--DHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDS 185

  Fly   404 ------------IFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLP 456
                        :|...|:.|...:..:|..:..|..||..|:                 ||:.|
  Fly   186 NNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAE-----------------ELVAP 233

  Fly   457 LVSGFNCEPFAVICHGDCWNNNILYKSTERGEL--EDVRLIDWQLMRYASPVTDLAYFLFTCTSR 519
            ..:..|     |:||.|.|::||:|...:...:  ....::|:||.:|.||..|:.:.|:...|.
  Fly   234 SKTIRN-----VLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASA 293

  Fly   520 RFRQRHLENMLEDYYEELGLQLIRLG 545
            ..|:...:..||.||:.|...|.|||
  Fly   294 EVRRAIYDECLEHYYKNLQHHLDRLG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 75/317 (24%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 78/335 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.