DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG5126

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:476 Identity:104/476 - (21%)
Similarity:186/476 - (39%) Gaps:95/476 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 EQVTQFLRQLVSQLWPELGANPELRLERASAKG----DNYLGVVWRLQ---AASDSKRS--LVVK 281
            :|:....|.||..::...|  |...||..|.:.    |.::..::.:.   ..::.||:  ::||
  Fly     6 QQLDYIERHLVYDIFKNFG--PSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVK 68

  Fly   282 LPPQNRVRRKQFFARPCFLRETAAYEVFLP----------LTALIQDKWKIIGDDRFRQHALCFG 336
            ........|:...:...|..|..||...||          |.:.:...|.          ..|:.
  Fly    69 FMKGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWV----------PCCYF 123

  Fly   337 TR-------QDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEK 394
            .|       .:.....:.|:.|...|:.|..| |.|..:.:..::......||:..|.|...|..
  Fly   124 ARFGHVEGLGNGRESVLALKHLKGDGYQLGPR-LTLRRDQLEAMVGLVGPFHALGYATKILQPNV 187

  Fly   395 MQQLQQ-LVD----------IFE--QRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFA 446
            ..:|:. :||          ||:  .|........:::..||.    ||..||..:...:|.  .
  Fly   188 HARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQ----LLQGADPGFGAAIER--L 246

  Fly   447 RGSYFE---LLLPLV--SGF-NCEP---FAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRY 502
            |..||:   |||..:  |.| ..:|   ||...|||...||:|:......:::.::.||:|.:|:
  Fly   247 REKYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRF 311

  Fly   503 ASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRL----------GERVEQLFPRPAF 557
            ::...||::|::..|....|:....::|..|:..: ::::.|          .:||:||....:|
  Fly   312 STTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSM-IEMLELVLRRNRNELTDDRVDQLLQEYSF 375

  Fly   558 DE---QVATKAAVGLLLAMMVLPIVTMQGQDVPDLQAISERIEAGATTDLHGAGFLG-----AGN 614
            :.   .....|..|.::.|..||.:....:|..:|..:.|       ||:||..|..     ||:
  Fly   376 ERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFE-------TDMHGPAFHQLSLDIAGD 433

  Fly   615 EATFKQRIREVILDCVDFNYI 635
            ||  .|.|.:.:....:..|:
  Fly   434 EA--NQEIFKTVRHAYEHGYM 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 70/346 (20%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.