DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG31300

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:414 Identity:93/414 - (22%)
Similarity:172/414 - (41%) Gaps:81/414 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 DRMESPVEQQEDTAKPDE-DLPNEQVTQFLRQLVS--QLWPELGANPELRLERASAKGDNYLGVV 265
            |::::  ||..|    || :.|.....||:.:::|  :..|||.. .:|::..|||:||:|..|:
  Fly     3 DKLDA--EQFND----DELEAPAWLNRQFIEEILSAYEDSPELKV-VDLKITPASAQGDHYASVM 60

  Fly   266 WRLQAASDS-----KRSLVVKLPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKII-- 323
            :|..|...:     .|.|::|..|:....:|.      .|.|:..:|..:.:...:..:::.|  
  Fly    61 FRTTAECTTAKGKFSRPLIIKAMPEQDGHKKD------MLSESHLFETEIGMYCQVLPEFERILR 119

  Fly   324 --GDDR-----FRQHALCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLH 381
              |||.     ...|:|       ||.:.::.|||...|:.: .|...::.|.::......||.|
  Fly   120 ESGDDTKLFVPCIYHSL-------EPRKVMIFEDLVPQGYYV-IRDRPVAQEELKTAFAKLAKWH 176

  Fly   382 AISLAGKRQLPEKMQQ--------------------LQQLVDIFEQRRDDHALGVYFENLKESAL 426
            |||:...::.|:.:::                    :|..:::.::..:......:||.:|    
  Fly   177 AISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIK---- 237

  Fly   427 SALLAPADDAYRVRLEAYFARGSYFELLLPLVSGFNCEPFAVICHGDCWNNNILYKSTE-RGELE 490
                    |.|..||:|...  .|.|       ....:.|.|:||||....|:::|:.: .|..|
  Fly   238 --------DKYMQRLQAVMK--EYHE-------NRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHE 285

  Fly   491 DVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRLGERVEQLFPRP 555
            |..|:|:|:........||.|.::.......|:...::::..|...|...|..:|...|......
  Fly   286 DTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAK 350

  Fly   556 AFDEQVATKAAVGLLLAMMVLPIV 579
            .:||....|.....||:.. ||::
  Fly   351 LWDEIHKNKYYDFFLLSTF-LPLI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 67/323 (21%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 67/323 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.