DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG31099

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:359 Identity:88/359 - (24%)
Similarity:138/359 - (38%) Gaps:91/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RSLVVKLPPQNRVRRKQFFARPCFL----------------------RETAAYEVFLPLTALIQD 318
            |:..|.||.|.:|:.:.|..:..|.                      ||...|...||   .:::
  Fly    42 RNCTVLLPIQVKVQLRDFTMKKLFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLP---KLEE 103

  Fly   319 KWKIIGDDRFRQHALCFGTRQDEPN-----ECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYA 378
            .::.:|      ..:.||.|....:     :.::||||....:....|....:...:::|:...|
  Fly   104 IYREVG------KKVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLA 162

  Fly   379 KLHAISLAGKRQLPEKMQQLQQLVDIFEQRRDDHALGVYFENLKESALSALLAP---ADDAYRVR 440
            :.||.|..    ..||......|:          ..||| ....||.|..|..|   .....|.|
  Fly   163 QFHAASAV----CVEKHGAFSNLL----------VNGVY-TKANESVLQELNDPEIFLSQLRRWR 212

  Fly   441 LEAYFARGSYFELLL-----PLVSGF------NCEPFAVICHGDCWNNNILYKSTERGELEDVRL 494
            |      |.:|...|     .||.|.      :...|.|:.|.|||.||:::|..:.|.:||..|
  Fly   213 L------GDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTAL 271

  Fly   495 IDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEEL--GLQLIRLGERVEQL-FPRPA 556
            :|:||::|.||..||.|.:.:...:..:....:||::.|:..|  .|:.:..|..:.|| ..|.|
  Fly   272 LDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNFGGSLPQLQHIRDA 336

  Fly   557 FDEQ------VATKAAVGLLLAMMVLPIVTMQGQ 584
            .::.      |.|:|          ||| ||..|
  Fly   337 LNKNGLAAYVVVTRA----------LPI-TMMNQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 74/312 (24%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 73/308 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.