DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG2004

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:406 Identity:106/406 - (26%)
Similarity:172/406 - (42%) Gaps:50/406 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 KGDNYLGVVWRL--------QAASDSKR---SLVVKLPPQNRVRRKQFFARPCFLRETAAYEVFL 310
            |||.||..|:|:        :...|.|:   |::||..|.|..||:.|.:...|..|...|...|
  Fly    42 KGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVL 106

  Fly   311 PLTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVML 375
            |.....|...:......|.::..|..:..|..|:.|.|||:...|:....|...:|:|.....|.
  Fly   107 PAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMR 171

  Fly   376 TYAKLHAISLAGKRQLPEKMQQLQQLVDIFEQRRDDHALG-----VYFENLKESALSALLAPADD 435
            |..:.|.::||               .:..:.:..:.|.|     .|.|:.:|.....||...:.
  Fly   172 TLGRFHGVALA---------------FNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENV 221

  Fly   436 AYRVRLEAY-----------FARGSYFELLLPLVSGFNCEPFAVICHGDCWNNNILYKSTERGEL 489
            |.....:.|           |.:...|:.|:.|||  .....:|..|||||..|.|.|..|||:.
  Fly   222 ATDAVKQIYPNSKYETVATNFLQPPLFDDLINLVS--TRSKLSVFGHGDCWTPNFLTKYNERGQS 284

  Fly   490 EDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRLGERVEQLFPR 554
            |::.:||:||.|.:|...||::|:::|||:..|::|.:.:|..|.|.....:..||...|.:...
  Fly   285 EEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISW 349

  Fly   555 PAFDEQVATKAAVGLLLAMMVLPIVTMQGQDVPDLQAISERIEAGATTDLHGAGFLGAGNEATFK 619
            .:..|::......|..:.:..||:..|:..:|.||..|.|.   ...||:..   :....|:..:
  Fly   350 ESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADLDGIKEN---AILTDIWN---ITPFKESAKQ 408

  Fly   620 QRIREVILDCVDFNYI 635
            ||:.::....:|..||
  Fly   409 QRLADIFKHAIDQGYI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 86/315 (27%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 85/314 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
55.020

Return to query results.
Submit another query.