DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and CG33301

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:379 Identity:99/379 - (26%)
Similarity:147/379 - (38%) Gaps:68/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RQLVSQLWPELGANPELRLERASAKGDNYLGVVWRL----QAASDS--------KRSLVVKLPPQ 285
            |..|.::|    |.|      |:.||:|::||:.|:    |....|        |::|..::|  
  Fly    23 RLQVLRIW----AKP------ATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVKQALSAEVP-- 75

  Fly   286 NRVRRKQFFARPCFLRETAAYEVFLP-LTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECIVLE 349
               :.:.||....:.||...||..|| |..|:|:...   |.:....|:..    |.....::||
  Fly    76 ---QAEVFFEYELYTREMDMYEFILPKLKELLQEAGL---DQKLTADAITV----DREYNTMILE 130

  Fly   350 DLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQLVDIFEQR---RDD 411
            ||:...|...:|...|.:.|....:...||.||.|:.    |.|:...|  |...|...   ||.
  Fly   131 DLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIV----LQERHPNL--LTKCFYTHFFSRDK 189

  Fly   412 HALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGFNCEPFAV-------I 469
            .|..|.|..|    ..|.|...|....:: |||   |.....|...:..:....:.|       :
  Fly   190 KAYSVVFAGL----FKAFLRFIDGQPNLK-EAY---GDKLHKLRTHIMEYGARAYDVGESDLKTL 246

  Fly   470 CHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYY 534
            .|||||..||:::..:.||...|..||:|.....||..||.||..|........:..| ::|.:|
  Fly   247 NHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEHHY 310

  Fly   535 EELGLQLIRLGERVEQLFPRPAFDE---QVATKAAVGLLLAMMVLPIVTMQGQD 585
            :.|...|    |:.......|...|   |...:..:. |||.|..|.:...|.:
  Fly   311 KALKANL----EKFSYKGSLPTLQEYRLQFERRRFMS-LLAHMFKPCMIYNGSE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 83/311 (27%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 84/315 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459591
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.