DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and T16G1.3

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:244 Identity:57/244 - (23%)
Similarity:103/244 - (42%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RETAAYEVFLPLTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDL 365
            ||...||:.        .||.:  ||......:.|..:.|.       |:|:...|::  .::|.
 Worm    85 REVNLYEII--------GKWNM--DDVLMSPKVFFSKKFDS-------ENLTKGFFAM--EYVDN 130

  Fly   366 SVEHVRRVMLTYAKLHAI--SLAGKRQLPEKMQQLQQ-------LVDIFEQRRDDHALGVYFENL 421
            ::.....:.|...:||:|  |||..:....|:.:.:|       |..|..:....:.|...||.:
 Worm   131 AITRHLYINLKSYELHSILKSLAVFQAESLKLNKREQESVTGYDLEKIVGKMFSQNGLNSIFEQV 195

  Fly   422 KESALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGFNCEPFAVICHGDCWNNNILYKSTER 486
            ::.....|...||     ::..:......|:|:..|.:....:. .|:.|||.|:.||::|. .:
 Worm   196 RQINKEELSEAAD-----KIAVFGVELVNFDLVKNLNNYLGIKK-NVLVHGDLWSANIMWKE-NK 253

  Fly   487 GELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYE 535
            .|....::||:|.:...:|..||.....:..|...||::.|.:||.:||
 Worm   254 DEFRVDKIIDYQSIHLGNPAEDLVRLFISTLSGSERQKYWEKLLEQFYE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 57/244 (23%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 57/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.