DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and E02C12.9

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:272 Identity:59/272 - (21%)
Similarity:111/272 - (40%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 RVRRKQFFARPCFLRETAAYEV-----FLPLTALIQDKWKIIG-----DDRFRQHALCFGTRQDE 341
            ::.:|:|..:..|..:..|..:     ::.:.|||...|..:.     ..:|..:.|.....:::
 Worm    22 KMMQKKFETKAKFGEDKNATNISEMKGYMSIIALINADWVDVEKGKNVPSKFAVYGLKKFIDEND 86

  Fly   342 PNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVML-----TYAKL------HAISLAGKRQLPEKM 395
            ....::::.:|.|    |:..:.||:.....:.|     |::.|      :....||.....|:|
 Worm    87 MKGFLIVDFVSNA----HDVGMYLSIPADELIPLVRGISTFSALGEKLSDNEKKFAGGSDFLERM 147

  Fly   396 QQLQQLVDIFEQRRDDHALGVY--FENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLV 458
              ..||.:....::  |..|:|  ||..|...:..|: .....|:..|:.|   ....|||    
 Worm   148 --FSQLFNSSSLQK--HFQGMYSVFEKEKYYQVDGLI-ETFVVYQKLLKKY---TKISELL---- 200

  Fly   459 SGFNCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQ 523
             ||.    :|:.|||.|.:|:::.....|:|:...:||||......|..|.|..:..|.|...|:
 Worm   201 -GFK----SVLNHGDLWQSNMIHSMENNGKLKLEAIIDWQSTVILPPGLDTAELIVGCLSAEDRR 260

  Fly   524 RHLENMLEDYYE 535
            ....::|..|::
 Worm   261 EKGHDLLLLYHK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 59/272 (22%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 59/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.