DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1561 and D1044.1

DIOPT Version :9

Sequence 1:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001367707.1 Gene:D1044.1 / 175763 WormBaseID:WBGene00017027 Length:376 Species:Caenorhabditis elegans


Alignment Length:203 Identity:41/203 - (20%)
Similarity:74/203 - (36%) Gaps:58/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 DEPNECIVLEDLSCAGFSLHNRFLDLSVE----HVRRVMLTYA---KLHAISLAGKRQLPEKMQ- 396
            ||.....:||.|:    ..|.:.:::|.|    :...|:...|   .||..:|..::..|.::. 
 Worm   149 DESQVLQLLEALA----HFHAKIIEISDEIPWKNYENVLYDAAYIRMLHNDTLDFEKLCPAELSG 209

  Fly   397 QLQQLVDIFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGF 461
            ::|::...|::.      ||.....|...|.                           :||    
 Worm   210 RIQEVKHAFDED------GVRNSEKKNEKLG---------------------------MPL---- 237

  Fly   462 NCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHL 526
                  ||||.|...:|:|: :.|.|:::  ..||:|.:.......|:...|....|...|:.:.
 Worm   238 ------VICHNDLNASNVLW-NNETGKIQ--AFIDFQHVSKGPVSFDIIRILCLGLSVENRRANT 293

  Fly   527 ENMLEDYY 534
            :..|..||
 Worm   294 QRYLNHYY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 41/203 (20%)
D1044.1NP_001367707.1 CHK 130..308 CDD:214734 41/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.