DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and KIF27

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_011517150.1 Gene:KIF27 / 55582 HGNCID:18632 Length:1427 Species:Homo sapiens


Alignment Length:412 Identity:120/412 - (29%)
Similarity:193/412 - (46%) Gaps:87/412 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIAVREAPY--RQFLGRREPSVVQFPPWSDGKSLIVDQNE-FHFDHAFPATISQDEMYQALILP 70
            |::|||..|.  ::.|...:..|...|   :.:.:|:.::. |.||..|....:|||:|...|.|
Human     6 VKVAVRIRPLLCKEALHNHQVCVRVIP---NSQQVIIGRDRVFTFDFVFGKNSTQDEVYNTCIKP 67

  Fly    71 LVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAI 135
            ||..|:||:..|..||||||:||:|::|......::....||:|||:.:||:.::   |:.....
Human    68 LVLSLIEGYNATVFAYGQTGSGKTYTIGGGHIASVVEGQKGIIPRAIQEIFQSIS---EHPSIDF 129

  Fly   136 QVYASFIEIYNEKPFDLL----------------GSTPHMPMVAARCQRCTCLPLHSQADLHHIL 184
            .|..|:||:|.|...|||                |:|     |....:.|   .:.|..::..:|
Human   130 NVKVSYIEVYKEDLRDLLELETSMKDLHIREDEKGNT-----VIVGAKEC---HVESAGEVMSLL 186

  Fly   185 ELGTRNRRVRPTNMNSNSSRSHAIVTI---------------------HVKSKTHHSRMNIVDLA 228
            |:|...|....|.||.:|||||||.||                     |:.||.|     .||||
Human   187 EMGNAARHTGTTQMNEHSSRSHAIFTISICQVHKNMEAAEDGSWYSPRHIVSKFH-----FVDLA 246

  Fly   229 GSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMA-----AGHTVIPYRDSVLTTVLQASLTAQ 288
            |||.|.:||:.|...:|.:.||.|||::..|:.::.     :.|  |||||:.:|.:|:.||...
Human   247 GSERVTKTGNTGERFKESIQINSGLLALGNVISALGDPRRKSSH--IPYRDAKITRLLKDSLGGS 309

  Fly   289 SYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNP---------------------MQVARQKQ 332
            :....:.|:||...:..|:|::|::...|:.:|..|                     .:..:.:|
Human   310 AKTVMITCVSPSSSNFDESLNSLKYANRARNIRNKPTVNFSPESDRIDEMEFEIKLLREALQSQQ 374

  Fly   333 SLAARTTHVFRQALCTSTAIKS 354
            :..::||.:.|:....:..|.|
Human   375 AGVSQTTQINREGSPDTNRIHS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 114/381 (30%)
KISc 8..318 CDD:276812 111/353 (31%)
ComEA 540..648 CDD:224472
KIF27XP_011517150.1 KISc_KIF4 4..342 CDD:276823 112/356 (31%)
KISc 5..348 CDD:214526 114/362 (31%)
COG1340 820..1077 CDD:224259
DUF4200 826..>910 CDD:290574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.