DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and Klp54D

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster


Alignment Length:583 Identity:161/583 - (27%)
Similarity:262/583 - (44%) Gaps:108/583 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIAVREAPYRQFLGR-REPSVVQFPPWSDGKSLIVDQNE--------------FHFDHAF-PAT 57
            :.:.||..|......| |..|.:|||  .:|: :|::.|:              |.::..| |..
  Fly   167 INVVVRVRPLNDKEKRDRHGSTLQFP--GNGQ-VILEGNDVGQKRSHNRDSVRVFTYNVVFEPGA 228

  Fly    58 ISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEIL--------PEHLGILP 114
            ..:|.:..:.|..:::..:|||.|||..|||||:||:::  :|.|.::.        |.| |::.
  Fly   229 TQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHT--LTGPPDLFVGKPNPKDPRH-GLIF 290

  Fly   115 RALGDIFERVTARQENNKDAIQVY-ASFIEIYNEKPFDLLGSTPHMPMVAARCQR---------- 168
            |:...:|:.:    :|.||...|. |||:|||||:..|||........:|.|..:          
  Fly   291 RSFLYLFQLI----KNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSGGFFVENL 351

  Fly   169 --CTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAIVTIHVKSK---------THHSRM 222
              ..|..|.   ||..:||.|.|||.|....||.:|||||.|:|:|:.|.         :.|.::
  Fly   352 FTVDCEELD---DLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFLSKHGKI 413

  Fly   223 NIVDLAGSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMA-----AGHTVIPYRDSVLTTVLQ 282
            |.|||||||..::|..||...:|..|||..|:.:...:.|::     .||  ||||||.||.:|.
  Fly   414 NFVDLAGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGH--IPYRDSQLTKLLA 476

  Fly   283 ASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNPMQVARQKQSL---AARTTHVFRQ 344
            .||........:||:||...:.:|||:|||:.:.||::|..|:.....:::|   ..|..|..:.
  Fly   477 DSLAGNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPREALILSLKRDIHALQM 541

  Fly   345 A---LCTSTAIKSNAANHNSIVVPKSKYSTTKPLSAVLHRTRSELGMTPKAKKRARELLELEETT 406
            .   |..:..:...||.:...|        ...|...|.|..|. |..|..|...:.|.||:.:.
  Fly   542 ENDHLKAALNLHHQAAPNGGPV--------ENLLELQLDRVSSG-GGVPVPKVDLQRLPELDGSE 597

  Fly   407 L-ELSSIH-IQDSSLSLLGFHSDSDKDRHLMPPPTGQEPRQASSQNSTLMGIVEETEPKESSKVQ 469
            | ||..:: :::.||.....|..:.::..|      ::......:|..|:..:|:.     :|| 
  Fly   598 LAELVKLYMVENESLRQENNHLFTVRETIL------RDQEIVCRENERLLKKLEDV-----NKV- 650

  Fly   470 QSMVAPTVPTTVRCQLFNTTISPISLRASSSQRELSGIQPMEETVVASPQQPCLRRSVRLASS 532
             .:.:|.:|.       ...|||.:.:.:......:..:|::     ||..|.|....|::.:
  Fly   651 -CVRSPLIPA-------RPAISPTTGKETPGTEIWTNPEPLQ-----SPPGPDLPIEQRMSEN 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 120/366 (33%)
KISc 8..318 CDD:276812 117/359 (33%)
ComEA 540..648 CDD:224472
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 121/367 (33%)
KISc 166..512 CDD:276812 117/359 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.