DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and sub

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:497 Identity:114/497 - (22%)
Similarity:191/497 - (38%) Gaps:134/497 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DGKSLIVDQNEFHFDHA--FPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGM 99
            |..|..|::.|.||...  |.:|:.|.::|...:.|   |::|....|.:.||.:|:||:|::  
  Fly   120 DSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTL-- 179

  Fly   100 TPPGEILPEHLGILPRALGDIF------------------------------------------E 122
              .|:.:  ..||:||||.:||                                          .
  Fly   180 --LGDDV--RAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCP 240

  Fly   123 RVTARQENNKDAIQ----------------VYASFIEIYNEKPFDLLGSTP-----------HMP 160
            .::|..:..|..|.                |:.||:|||||..:|||...|           ::.
  Fly   241 DISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLK 305

  Fly   161 MVAAR----CQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAIVTIHV-----KSK 216
            :|..:    .:..|.:.:.|..:...:|.||.:......|::|:||||||.:.|:.:     ...
  Fly   306 IVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGI 370

  Fly   217 THHSRMNIVDLAGSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMAAGHTV--------IPYR 273
            |..|.....||||||.|..||..|:..:|..|||..|:.:.:   .:.|..||        ||||
  Fly   371 TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGR---CLDAASTVQKKKNADIIPYR 432

  Fly   274 DSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKL------------------ 320
            ||.||.:|||:|..:..|..:..::|......|.|:.|.|.:.||.:                  
  Fly   433 DSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFM 497

  Fly   321 ---------------RLNPMQVARQKQSLAARTTHVFRQALCTSTAIKSNAANHNSIVV-PKSKY 369
                           .|....|..|.:....:..||.:..|......:...|.:..|:. .|.:|
  Fly   498 EFSKMSTCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQY 562

  Fly   370 STTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSS 411
            ........::.:..||..::.:.::...::.:|::...||.:
  Fly   563 EDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLKDEIEELKN 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 100/408 (25%)
KISc 8..318 CDD:276812 97/368 (26%)
ComEA 540..648 CDD:224472
subNP_001286548.1 KISc 89..477 CDD:276812 97/368 (26%)
Kinesin 93..479 CDD:278646 99/370 (27%)
GBP_C <512..603 CDD:303769 14/90 (16%)
coiled coil 576..586 CDD:293879 2/9 (22%)
coiled coil 592..603 CDD:293879 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.