DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and Kif3C

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster


Alignment Length:481 Identity:133/481 - (27%)
Similarity:208/481 - (43%) Gaps:72/481 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIAVREAPYRQFLGRRE-PSVVQFPPW----SDGKSLIVDQNEFHFDHAFPATISQDEMYQALI 68
            :::.||..|..|....|. .::|:...:    ::..:.|..|.:|.||..:......:.:|..:.
  Fly     5 IKVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARISQQKKFIFDSVYNMKTDTEVIYDEMC 69

  Fly    69 LPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKD 133
            ..||:..:||:..|..||||||.||:::|   ...|......||:|:....||||::........
  Fly    70 YSLVESTIEGYNGTIFAYGQTGCGKTHTM---QGDENFSNSTGIIPKCFDHIFERISMTTNVRYL 131

  Fly   134 AIQVYASFIEIYNEKPFDLLGSTPH----------MPMVAARCQRCTCLPLHSQADLHHILELGT 188
            |:..|   :|||||:..|||....:          :|.:.......|..|:.:....:..|..|.
  Fly   132 ALVTY---LEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGN 193

  Fly   189 RNRRVRPTNMNSNSSRSHAIVTIHVKSKTH-------------HSRMNIVDLAGSEGVRRTGHEG 240
            :||....|.||.||||||.|.||.::....             ..::::|||||||..|:||.:|
  Fly   194 KNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQG 258

  Fly   241 VARQEGVNINLGLLSINKVVMSMAAGHTV-IPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDL 304
            ...:|...|||.|.::..|:.|:..|... :|:|||.||.:||.||...:....::||||.....
  Fly   259 DRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIHY 323

  Fly   305 SETLSTLRFGTSAKKLRLNPM-----QVARQKQSLAARTTHVFRQALCTSTAIKSNAANHNSIVV 364
            .||:||||:.:.||.:...|.     :.||.:|  ........::.|..|..|.:...:.|.|: 
  Fly   324 DETISTLRYASRAKNISNKPKINEDPKDARLRQ--YQNEILYLKRMLQESQQIINKNNDPNKII- 385

  Fly   365 PKSKYSTTKPLSAVLHRTRS--------ELGMTPKAKKRARE----------LLELEETTLELSS 411
             ||      ||..:.|...:        :||...||..:...          :...||..|:..|
  Fly   386 -KS------PLKIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNFPLIQSKEEVQLQARS 443

  Fly   412 IHIQDSSLSLLG---FHSDSDKDRHL 434
             .|.....||:|   .|....|::|:
  Fly   444 -RIDLIKRSLIGGERIHDFELKEKHM 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 104/344 (30%)
KISc 8..318 CDD:276812 102/337 (30%)
ComEA 540..648 CDD:224472
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 104/339 (31%)
Kinesin 10..339 CDD:278646 103/334 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.