DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and Klp68D

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster


Alignment Length:488 Identity:146/488 - (29%)
Similarity:238/488 - (48%) Gaps:79/488 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIAVREAPY-RQFLGRREPSVVQFPPWSDGKSL--IVDQNE-----FHFDHAFPATISQDEMYQ 65
            |::.||..|. .:....|.|.||...|......|  :||.|:     |.:|.|:.|:.:|..:|.
  Fly    20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYH 84

  Fly    66 ALILPLVDKLLEGFQCTALAYGQTGTGKSYSM-GMTPPGEILPEHLGILPRALGDIFERVTARQE 129
            .::.|||..:||||.....|||||||||:::| |:....|:    :||:||....|:..:. |.|
  Fly    85 EVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDEL----MGIIPRTFEQIWLHIN-RTE 144

  Fly   130 NNKDAIQVYASFIEIYNEKPFDLL------------GSTPHMP-MVAARCQRCTCLPLHSQADLH 181
            |.:..:.|  |::|||.|:..|||            ||..::| :.|..|:        |..|:.
  Fly   145 NFQFLVDV--SYLEIYMEELRDLLKPNSKHLEVRERGSGVYVPNLHAINCK--------SVEDMI 199

  Fly   182 HILELGTRNRRVRPTNMNSNSSRSHAIVTIHVK---SKTHH---SRMNIVDLAGSEGVRRTGHEG 240
            .::::|.:||.|..||||.:|||||||..|.::   ::|:.   .::|::||||||...:||...
  Fly   200 KVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAGSERQSKTGASA 264

  Fly   241 VARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLS 305
            ...:|...|||.|.|:..|:.::|.....:|||||.||.:||.||...|....:|.|.|...:.:
  Fly   265 ERLKEASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYN 329

  Fly   306 ETLSTLRFGTSAKKLRLNPM-----QVARQKQSLAARTTHVFRQALCTSTAIKSNAANHNSIVVP 365
            |||:|||:.:.||.::..|:     |.|:.|:                   .:........::.|
  Fly   330 ETLTTLRYASRAKSIQNQPIKNEDPQDAKLKE-------------------YQEEIERLKRLIGP 375

  Fly   366 KSKYSTTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSSIH--IQDSSLSLLGFHSDS 428
            :.:..:.|.::|...|.:.     ||.:...:|:.:    :|::|:|.  ::|.| ...|..|:|
  Fly   376 QQQQRSEKQVTAKKQRVKK-----PKKETVTKEMSD----SLQVSTIEQPVEDDS-DPEGAESES 430

  Fly   429 DKDRHLMPPPTGQEPRQASSQNSTLMGIVEETE 461
            ||:.......:.:|..:...:||.|...:.|.|
  Fly   431 DKENEAEVAKSNEELERERVENSKLAAKLAELE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 119/343 (35%)
KISc 8..318 CDD:276812 117/336 (35%)
ComEA 540..648 CDD:224472
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 119/338 (35%)
KISc 20..351 CDD:214526 120/345 (35%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.