DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and Klp61F

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster


Alignment Length:740 Identity:174/740 - (23%)
Similarity:300/740 - (40%) Gaps:172/740 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEIL----- 106
            :|.||.:|.....|.::|..::.||::::|.|:.||..|||||||||:::|......|:.     
  Fly    63 KFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWED 127

  Fly   107 PEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLG------------STPHM 159
            ...:||:||||..:|:.:...:......|    |::|:|||:..|||.            ||...
  Fly   128 DSDIGIIPRALSHLFDELRMMEVEYTMRI----SYLELYNEELCDLLSTDDTTKIRIFDDSTKKG 188

  Fly   160 PMVAARCQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAI--VTIHVKSK------ 216
            .::....:.   :|:||:.|::.:||.|...|:...|.||:.|||||.:  :.:|::..      
  Fly   189 SVIIQGLEE---IPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENGIEGED 250

  Fly   217 -THHSRMNIVDLAGSEGVRRTGHE-GVARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTT 279
             ....::|:|||||||.|.:.|:| |:..:|.||||..||::.:|:.::......:|||:|.||.
  Fly   251 MLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVPYRESKLTR 315

  Fly   280 VLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNP-------------------- 324
            :||.||..::..:.:|.|||...|:.||||||.:...||.::..|                    
  Fly   316 LLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTKKTVLKEYTEEID 380

  Fly   325 -----MQVARQKQS--LAART-----------THVFRQALCTSTAIKSNAANHNSIV--VPKSKY 369
                 :..||.|..  ||..|           .....:.:....|:|....|...|.  |..|..
  Fly   381 KLKRDLMAARDKNGIYLAEETYGEITLKLESQNRELNEKMLLLKALKDELQNKEKIFSEVSMSLV 445

  Fly   370 STTKPLSAV---LHRTRSELGMT----PKAKKRARELLELEETTLELSSIHIQDSSLSLLG---- 423
            ..|:.|...   |..|:..|.:|    .|.|:|.:|..||..:.::...: :...:..:|.    
  Fly   446 EKTQELKKTEENLLNTKGTLLLTKKVLTKTKRRYKEKKELVASHMKTEQV-LTTQAQEILAAADL 509

  Fly   424 -------FHSDSDKDRHLMPPPTGQEPRQASSQ-------NSTLMG----IVEETEPKESSKVQQ 470
                   .|...::.|.|     .::.|::..|       |..::|    :.::.:.....::.|
  Fly   510 ATDDTHQLHGTIERRREL-----DEKIRRSCDQFKDRMQDNLEMIGGSLNLYQDQQAALKEQLSQ 569

  Fly   471 SMVAPTVPTTVRCQLFNTTISPISLRASSSQRELSGIQPMEETVVASPQQPC-----LRRSVRLA 530
            .||             |::.....|..:||:    .|:.::|....|.|...     |...|...
  Fly   570 EMV-------------NSSYVSQRLALNSSK----SIEMLKEMCAQSLQDQTNLHNKLIGEVMKI 617

  Fly   531 SSMRSQNYGAIPKVM------------------------NLRRSTRLAGIREHATSVVVKNETDA 571
            |...||.:  :.|:|                        |.|....|..::|...:::..:....
  Fly   618 SDQHSQAF--VAKLMEQMQQQQLLMSKEIQTNLQVIEENNQRHKAMLDSMQEKFATIIDSSLQSV 680

  Fly   572 IPHLRSTVQKKRTRNVKPAPKAWMANNTKCFL----------DLLNNGNVKQLQEIPGIGPKSAF 626
            ..|.:...:|.........|.|....|.:..|          |.|....:.|:::|..:..|::.
  Fly   681 EEHAKQMHKKLEQLGAMSLPDAEELQNLQEELANERALAQQEDALLESMMMQMEQIKNLRSKNSI 745

  Fly   627 SLALH-----RSRLGCFENLFQVKS 646
            |:::|     .|||.....:..:||
  Fly   746 SMSVHLNKMEESRLTRNHRIDDIKS 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 102/329 (31%)
KISc 8..318 CDD:276812 99/297 (33%)
ComEA 540..648 CDD:224472 24/146 (16%)
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 102/308 (33%)
Kinesin 25..356 CDD:278646 101/299 (34%)
Microtub_bind 923..>1009 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.