DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and CG5004

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_573195.1 Gene:CG5004 / 32698 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster


Alignment Length:471 Identity:92/471 - (19%)
Similarity:158/471 - (33%) Gaps:145/471 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 QADLHHILELGTRNRRVRPTNMNSNSSRSH------------AIVTIHVKSKTHHS--------R 221
            |..|..::.....|:.:....:|..|..|.            |..:||::.:....        :
  Fly   520 QQQLDRMVPAKRSNKNINNLTLNLQSVESQTQSPKPSRKPAPAPRSIHLEQRQRRELIQRRKQLK 584

  Fly   222 MNIVDL---AGSEGVR-RTGHEGVARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQ 282
            ..:.:|   ||.||:. :.|.:.:|......:.|..|. |:|....|..:.         |.|::
  Fly   585 RELAELPPSAGIEGLELKLGEQPLAPSASPRLQLQALQ-NRVCRLEAQRNA---------TRVME 639

  Fly   283 ASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNPMQVARQKQSLAARTTHVFRQALC 347
            .:               .|..|.:::...:  ...||||    .:.:||.:.|.....:  |.:|
  Fly   640 EN---------------QQAKLKQSIEIKQ--DQLKKLR----AMLKQKPNNACLKEEL--QLVC 681

  Fly   348 TSTAIKSNAANHNSIVVPKSKYSTTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSSI 412
            .|.               :|...|.:.|........||...:.:..||..:.|.||   .||:::
  Fly   682 ESL---------------ESDRKTFEDLEFQYFEEESEHHASHEEFKRQEQRLMLE---AELAAL 728

  Fly   413 HIQDSSLSLLGFHSDSDKDRHLMPPPTGQEPRQASSQNST------------LMGIVEETEPKE- 464
            .||      :|              |..:||...:|..||            |.|..|...||. 
  Fly   729 RIQ------IG--------------PDEEEPGSPTSPGSTGSNLVNGVMSQSLFGSAELLCPKRR 773

  Fly   465 ------SSKVQQSM-------VAPTVPTTVRCQLFNT----TISPISLRASSSQRELSGIQPMEE 512
                  |..|.::|       ...:.|..:..|||..    :...||... |.|.:...:.|:|.
  Fly   774 NQEDLMSKSVNENMFYNHKIEANTSTPKRLPLQLFEDLAGGSCEQISFNL-SLQGDRFEVNPLER 837

  Fly   513 TVVASPQQPCLRRSVRLASSMR-SQNYGAIPK----VMNLRRSTRLAGIREHATSVVVKNETDAI 572
            .|   |.|..:.||.::|:... |.:.||..|    :|.:.|:.:|         ::.:.....|
  Fly   838 RV---PSQDDIDRSCKVANDAPISASQGASTKIFDSIMEIERNRKL---------LLAQQGHQVI 890

  Fly   573 PHLRSTVQ--KKRTRN 586
            .|.|..:.  ||::.:
  Fly   891 EHERQKMYDLKKKSHD 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 29/171 (17%)
KISc 8..318 CDD:276812 25/164 (15%)
ComEA 540..648 CDD:224472 10/53 (19%)
CG5004NP_573195.1 FHA 41..104 CDD:278899
PH-like 1142..1242 CDD:302622
PH 1143..1237 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.