DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and Klp10A

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001285109.1 Gene:Klp10A / 32049 FlyBaseID:FBgn0030268 Length:805 Species:Drosophila melanogaster


Alignment Length:512 Identity:133/512 - (25%)
Similarity:226/512 - (44%) Gaps:81/512 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIAVREAPY-RQFLGRREPSVVQFPPWSDGKSLIV--------------DQNEFHFDHAFPATI 58
            :.:.||:.|. |:.:.|:|..|:..|    .|.:::              :.::|.||:||..|.
  Fly   279 ITVCVRKRPISRKEVNRKEIDVISVP----RKDMLIVHEPRSKVDLTKFLENHKFRFDYAFNDTC 339

  Fly    59 SQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFER 123
            ....:|:....|||..:.||...|..||||||:||:::||....|::.....||...|..|:|..
  Fly   340 DNAMVYKYTAKPLVKTIFEGGMATCFAYGQTGSGKTHTMGGEFNGKVQDCKNGIYAMAAKDVFVT 404

  Fly   124 VTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQA--DLHHILEL 186
            :...:....:.: |.|||.|||:.|.||||.....:.::....|:...:.|..:.  .:..:|:|
  Fly   405 LNMPRYRAMNLV-VSASFFEIYSGKVFDLLSDKQKLRVLEDGKQQVQVVGLTEKVVDGVEEVLKL 468

  Fly   187 ---GTRNRRVRPTNMNSNSSRSHAIVTIHVK---SKTHHSRMNIVDLAGSE-GVRRTGHEGVARQ 244
               |...|....|:.|||||||||:..|.::   |...|.:.:.:||||:| ||..:..:...|.
  Fly   469 IQHGNAARTSGQTSANSNSSRSHAVFQIVLRPQGSTKIHGKFSFIDLAGNERGVDTSSADRQTRM 533

  Fly   245 EGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLT-FLACISPHQCDLSETL 308
            ||..||..||::.:.:.::......:|:|.|.||.||:.|...:...| .:|.|||.......||
  Fly   534 EGAEINKSLLALKECIRALGKQSAHLPFRVSKLTQVLRDSFIGEKSKTCMIAMISPGLSSCEHTL 598

  Fly   309 STLRFGTSAKKLRL------------NPMQVARQKQSLAARTTHVFRQALCTST---AIKSN--- 355
            :|||:....|:|.:            .|:::...::.......|.....|..::   |.:||   
  Fly   599 NTLRYADRVKELVVKDIVEVCPGGDTEPIEITDDEEEEELNMVHPHSHQLHPNSHAPASQSNNQR 663

  Fly   356 --AANHNSIVVPKSKYSTTK----------PLSAVL-HRTRSELGMTPKAKKRARELLELEETTL 407
              |::|:..|:..:..:..|          .||::. |....||.:..:|   ..:|.:.||..:
  Fly   664 APASHHSGAVIHNNNNNNNKNGNAGNMDLAMLSSLSEHEMSDELIVQHQA---IDDLQQTEEMVV 725

  Fly   408 E--------LSSIHIQDSSLSLLGFHSDSDKDRHLMPPPTGQEPRQASSQNSTLMGI 456
            |        |.:...:..:|..|..:.|.|:|.:.         ::..|..|.|:.|
  Fly   726 EYHRTVNATLETFLAESKALYNLTNYVDYDQDSYC---------KRGESMFSQLLDI 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 103/352 (29%)
KISc 8..318 CDD:276812 101/333 (30%)
ComEA 540..648 CDD:224472
Klp10ANP_001285109.1 KISc_KIF2_like 278..608 CDD:276818 101/333 (30%)
Kinesin 284..609 CDD:278646 100/329 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.