DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and CG32318

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:138 Identity:37/138 - (26%)
Similarity:57/138 - (41%) Gaps:38/138 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLG 111
            :|.||.:|.....|.::|..::.||::::|.|:.||..||||||.      .:.|     |:.|.
  Fly    63 KFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN------NLRP-----PKSLY 116

  Fly   112 ILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPH-MPMVAARCQRCTCLPLH 175
            |..|.:.|                  |..| |:.:.:...|..::.| :|       |.....|.
  Fly   117 IEVRCMED------------------YGKF-ELDDGEVIHLKKNSQHYLP-------RAQVESLV 155

  Fly   176 SQADLHHI 183
            .|..||||
  Fly   156 RQGILHHI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 37/138 (27%)
KISc 8..318 CDD:276812 37/138 (27%)
ComEA 540..648 CDD:224472
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.