DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nod and Kif27

DIOPT Version :9

Sequence 1:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_932167.1 Gene:Kif27 / 246209 RGDID:621071 Length:1394 Species:Rattus norvegicus


Alignment Length:618 Identity:158/618 - (25%)
Similarity:254/618 - (41%) Gaps:163/618 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRIAVREAPY--RQFLGRREPSVVQFPPWSDGKSLIVDQNE-FHFDHAFPATISQDEMYQALILP 70
            :::|||..|.  ::.|...:..|...|   ..:.:|:.::. |.||..|....:|||:|...|.|
  Rat     6 IKVAVRIRPLLCKEVLHNHQVCVRDIP---KTQQIIIGRDRVFTFDFVFGKNSTQDEVYSTCIKP 67

  Fly    71 LVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAI 135
            ||..|:||:..|..||||||:||:|::|......::....||:|||:.:||:.::.   |.....
  Rat    68 LVLSLIEGYNATVFAYGQTGSGKTYTIGGGHVASVVDGQKGIIPRAIQEIFQSISG---NPNIDF 129

  Fly   136 QVYASFIEIYNEKPFDLL----------------GSTPHMPMVAARCQRCTCLPLHSQADLHHIL 184
            ::..|:||:|.|...|||                |:|  :.:.|..||      :.|..|:..:|
  Rat   130 KIKVSYIEVYKEDLRDLLELETSMKDLHIREDEKGNT--VIVGAKECQ------VDSVEDVMGLL 186

  Fly   185 ELGTRNRRVRPTNMNSNSSRSHAIVTI---------------------HVKSKTHHSRMNIVDLA 228
            ::|...|....|.||.:|||||||.||                     |:.||.|     .||||
  Rat   187 QVGNAARHTGTTQMNEHSSRSHAIFTISVCQVGKSAEATEDGEWCSHRHIVSKFH-----FVDLA 246

  Fly   229 GSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMA-----AGHTVIPYRDSVLTTVLQASLTAQ 288
            |||.|.:||:.|...:|.:.||.|||::..|:.::.     :.|  :||||:.:|.:|:.||...
  Rat   247 GSERVTKTGNTGERFKESIQINSGLLALGNVISALGDPRRKSSH--VPYRDAKITRLLKDSLGGS 309

  Fly   289 SYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNP-MQVARQKQSLAARTTHV--FRQALCTST 350
            :....:.|:||...|..|:|::|::...|:.:|..| :..:.|...:......:  .|:||.:..
  Rat   310 AKTVMITCVSPSSSDFDESLNSLKYANRARNIRNKPTLNFSPQADRMDEMEFEIKLLREALQSHQ 374

  Fly   351 AIKSNAANHNSIVVPKSKYSTTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSSIHIQ 415
            |..|..:...|..||..            :|..|               ||.:...|:...:..|
  Rat   375 ASISQTSQTASENVPDQ------------NRIHS---------------LEEQIAQLQEECLGYQ 412

  Fly   416 DSSLSLLGFHSD-------SDKDRH----------------LMPPPTGQE--PRQASSQNSTLMG 455
            |.......|..|       :.|.:|                |.|.|..|.  ..:...|:.|::.
  Rat   413 DCIEQAFAFLVDLKDAVRLNQKQQHKLQQWFSRTQEVRKAVLTPLPGNQSIGNLEEGPQHVTVLQ 477

  Fly   456 IVEETEPKESSKVQQSMVAPTVPTTVRCQLFNTTISPISLRASSSQRELSGIQPMEETVVASPQQ 520
            :     .:|..|.|.::.|..|..|                    |:||.    :||        
  Rat   478 L-----KRELKKYQCALAADQVVFT--------------------QKELE----LEE-------- 505

  Fly   521 PCLRRSVRLASSMRSQNYGAIPKVMNLRRSTRL 553
              |||.::|   |..::.|....:...::..||
  Rat   506 --LRRQMQL---MAQESKGHAVSLKEAQKVNRL 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nodNP_001285129.1 KISc 8..325 CDD:214526 113/361 (31%)
KISc 8..318 CDD:276812 110/353 (31%)
ComEA 540..648 CDD:224472 2/14 (14%)
Kif27NP_932167.1 KISc_KIF4 4..342 CDD:276823 111/356 (31%)
KISc 5..348 CDD:214526 113/362 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 642..664
SbcC <702..1222 CDD:223496
DUF4200 789..>884 CDD:290574
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1267..1340
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1375..1394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.