DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and STP4

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:55/258 - (21%)
Similarity:85/258 - (32%) Gaps:74/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 QCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFK 365
            |.:...|...|.:|||.:    .||.......|.:.:..:....::...|     ||.:..|   
Yeast   235 QLNSSSSASALPSIHSPL----TNEHTSRYSSSLKDSAKITKQRKKKECP-----ICHNFYA--- 287

  Fly   366 TKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCE--------- 421
               ||..||.| |......|. :|..||...:..|.|.:|...|        ||.|         
Yeast   288 ---NLSTHKST-HLTPEDRPH-KCPICQRGFARNNDLIRHKKRH--------WKDEFMQIYARES 339

  Fly   422 --QCGLE--------------KGSRAKLAAH--------IRYHHPKEYHKCTHCAK-EFKSSR-S 460
              ..|.:              ..|..||||.        ::.:..|..:|.....| .:.|:. :
Yeast   340 DNNSGADDQDDTARTSANNDSDDSNDKLAASSSSEETKLLKKNQLKSLYKIKGAFKCPYNSTLIN 404

  Fly   461 LEEHTATHTGQDLY-ECAFCERT--FKNSGNMHKHRRQMHAAQVAALQQQKKVPP-SKRKDKG 519
            |:.....|..:.|| |...|.:|  |........|.:.:|.          :.|| :|::|:|
Yeast   405 LDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHF----------EYPPKTKKEDRG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368
C2H2 Zn finger 299..319 CDD:275368 6/17 (35%)
C2H2 Zn finger 327..348 CDD:275368 1/20 (5%)
C2H2 Zn finger 357..376 CDD:275368 6/18 (33%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 420..440 CDD:275368 7/52 (13%)
C2H2 Zn finger 448..468 CDD:275368 3/21 (14%)
C2H2 Zn finger 476..494 CDD:275368 4/19 (21%)
STP4NP_010235.1 COG5048 14..442 CDD:227381 49/231 (21%)
C2H2 Zn finger 279..296 CDD:275368 9/28 (32%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.