DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and AT3G29340

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:540 Identity:108/540 - (20%)
Similarity:179/540 - (33%) Gaps:180/540 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QCWQQLADFEQFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEECNEID 120
            :|:|.|...::....:.:|      |..:.|||.....:|.|  ..||  .|.:..:.:.|.:|.
plant    53 ECYQALGGHQRIHRPIKEK------LSKQEFSEVYPRKSKLQ--KRPE--SSSSCYECKVCGKIF 107

  Fly   121 GDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPK------TQAVKAKARTKTHKAEADE 179
            |........:.:..::.||:              |.|..:      ::|.|..::..:.|...:|
plant   108 GCYRGLGGHTKLHRSTKREL--------------ASTQDENSLLDSSEAKKIVSQPSSFKVSQEE 158

  Fly   180 D--EDAEGEGDPESRSSNSREMDSYIALHGRLE----------CCICGGDEQFPNFAEMKRHFRN 232
            .  ...|.:.|.....|:|..:.|  .|..:|:          |.|||  :.|.....:..|.|.
plant   159 KFLHCVELKQDFSEPLSHSGALPS--TLRSKLQTKTQWKSSCHCKICG--KSFVCSQGLGNHKRV 219

  Fly   233 HHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSF 297
            |.:..| .:.|:|:|.:            |.|.|...:.:|::|.:.|      .|..::::...
plant   220 HREISG-KLACKRKYTE------------DYNPFSDSLKAKKIVKKPS------SFEVSQEEKIL 265

  Fly   298 ACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPA--FVPFI---- 356
            .|.:..:.|.:   |..||..      ::...|.:|.:.....|.: .:|.|..  |..|:    
plant   266 HCVELKQDFGE---LLAHSGF------DKSISCSKSIKVKKVARKN-EKTEDSTSLFGVFVGEMS 320

  Fly   357 -----CDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLR 416
                 |.:||.||.|.:.:..|:| :|......           :.|||.|.            |
plant   321 QRLHGCKTCGRKFGTLKGVYGHQR-MHSGNHNR-----------IEDENGLE------------R 361

  Fly   417 QWKCEQCGLEKGSR------------AKLAAHIRYHH---------------------------- 441
            .|     ||:|.||            :...|.|..|.                            
plant   362 IW-----GLKKKSRVCSVSAFDRFKGSSFMAEIEKHEVIEAALNLVMLCQGVYDFASISNLPLGD 421

  Fly   442 ---PKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMHAAQVAA 503
               ..|...|....|..|.|||            .|:|:.||::|..|..:..|:|         
plant   422 GFMDLELKPCPLRRKLQKKSRS------------SYKCSICEKSFVCSQALGSHQR--------- 465

  Fly   504 LQQQKKVP-PSKRKDKGDLL 522
            |.:.|.|| |...:|...||
plant   466 LHRWKLVPKPEYIEDDSSLL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 4/24 (17%)
C2H2 Zn finger 268..289 CDD:275368 3/20 (15%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..348 CDD:275368 3/20 (15%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 4/19 (21%)
C2H2 Zn finger 420..440 CDD:275368 7/31 (23%)
C2H2 Zn finger 448..468 CDD:275368 6/19 (32%)
C2H2 Zn finger 476..494 CDD:275368 6/17 (35%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 3/14 (21%)
C2H2 Zn finger 45..65 CDD:275368 3/11 (27%)
C2H2 Zn finger 100..120 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.