DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11695 and ZNF692

DIOPT Version :9

Sequence 1:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_011542525.1 Gene:ZNF692 / 55657 HGNCID:26049 Length:625 Species:Homo sapiens


Alignment Length:337 Identity:78/337 - (23%)
Similarity:124/337 - (36%) Gaps:64/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KSLCTQC--WQQLADFEQFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEP-EIDVSPAAAD 112
            :|.|::.  .|:|||.|.      :.....|:.::.....|......:.:.|.| |.:..||.| 
Human   296 RSWCSEATSGQELADLES------EHDERTQEARLPSSEPDAPRLLPSPVTCTPKEGETPPAPA- 353

  Fly   113 NEECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEA 177
                      |.|:..:....:.|....|.|.|...|::...:.|....|..:|.|.|.:....|
Human   354 ----------ALSSPLAVPALSASSLSSRAPPPAEVRVQPQLSRTPQAAQQTEALASTGSQAQSA 408

  Fly   178 DE---DEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGY 239
            ..   |||....|....|.:..||:         :.|...|....|.|     |.:.|||     
Human   409 PTPAWDEDTAQIGPKRIRKAAKREL---------MPCDFPGCGRIFSN-----RQYLNHH----- 454

  Fly   240 VVCCQRRYKKRALYVDHLHMHNDPNYFRC--KICSKQLVSRISYDVHMLRFHPNKDDLSFACDQC 302
                 ::|:       |:|..:    |.|  ..|.|....:.....|| :.|  .|...:.|:.|
Human   455 -----KKYQ-------HIHQKS----FSCPEPACGKSFNFKKHLKEHM-KLH--SDTRDYICEFC 500

  Fly   303 SKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRR-THDPAFVPFICDSCGAKFKT 366
            ::.|.....|.||.|:|..|:..||:.|..:.|....|..|.|: ....|.:.|.|:.||.:|:.
Human   501 ARSFRTSSNLVIHRRIHTGEKPLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEK 565

  Fly   367 KQNLLVHKRTVH 378
            ..::..|:...|
Human   566 PDSVAAHRSKSH 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 8/31 (26%)
C2H2 Zn finger 268..289 CDD:275368 5/22 (23%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 6/21 (29%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368
C2H2 Zn finger 420..440 CDD:275368
C2H2 Zn finger 448..468 CDD:275368
C2H2 Zn finger 476..494 CDD:275368
ZNF692XP_011542525.1 zf-C2H2 465..489 CDD:278523 6/24 (25%)
C2H2 Zn finger 467..489 CDD:275368 5/22 (23%)
COG5048 490..>591 CDD:227381 25/88 (28%)
zf-C2H2 495..517 CDD:278523 7/21 (33%)
C2H2 Zn finger 497..517 CDD:275368 7/19 (37%)
zf-H2C2_2 509..534 CDD:290200 9/24 (38%)
C2H2 Zn finger 525..545 CDD:275368 6/19 (32%)
C2H2 Zn finger 556..577 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.